SKU: 65578841527

LL-37

Sale price$58.50 Regular price$65.00
Save 10%

Pay in installments of $16.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 13 - Aug 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LL-37LL 37: Pioneering Antimicrobial Peptide for Research Advance Your Immunology Studies with LL 37 LL 37, a cathelicidin derived antimicrobial peptide, has emerged as a crucial focus in immunology and microbiology research. This multifunctional peptide offers exciting possibilities for studying innate immune responses and novel antimicrobial strategies. LL 37 Specifications: Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES Molecular Weight: 4493. 33 g mol

LL-37: Pioneering Antimicrobial Peptide for Research

Advance Your Immunology Studies with LL-37

LL-37, a cathelicidin-derived antimicrobial peptide, has emerged as a crucial focus in immunology and microbiology research. This multifunctional peptide offers exciting possibilities for studying innate immune responses and novel antimicrobial strategies.

LL-37 Specifications:

  • Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • Molecular Weight: 4493.33 g/mol
  • Purity: >95%
  • Available in 10mg vials

Research Applications:

  • Antimicrobial mechanism studies
  • Innate immunity investigations
  • Wound healing research
  • Anti-biofilm activity analysis

Why Source LL-37 From Us?

  • Rigorous quality control ensures consistent purity
  • Comprehensive documentation, including certificates of analysis
  • Competitive pricing for research budgets
  • Prompt, discreet shipping to research facilities worldwide

Expand Your Research Horizons

Incorporate LL-37 into your studies to explore its diverse biological activities. Whether you’re investigating antimicrobial resistance, wound healing processes, or immune modulation, LL-37 offers a versatile tool for cutting-edge research. To buy LL-37 10mg or inquire about bulk orders, please contact our dedicated research support team. We’re committed to supporting your groundbreaking work in immunology and microbiology. Important: LL-37 is intended for research use only. Not for diagnostic, therapeutic, or human use. Elevate your antimicrobial peptide research – purchase LL-37 through our trusted platform today.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 65578841527

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 11 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Dan - Pool And Spa
Boise, US
★★★★★ 5
Best. Shirts. Ever.
Size: 3X-Large, Color: 3 Pack-black
These are great t-shirts. They fit great, very lightweight but not cheap-ish. There is some sort of stretchy material mixed in with the cotton which is good. I like my t-shirts a little bit large, so i ordered the next size bigger. I have since ordered 2 more packs of these shirts. Would def recommend. A+
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 10, 2026
K
Verified Purchase
Kindle Customer
Whiting, US
★★★★★ 5
Great fit and washes well
Size: Large, Color: 3 Pack-black, Dark Gray, Khaki
The fit is average and they wash well
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
C
Verified Purchase
Christopher Cummons
Lexington, US
★★★★★ 5
That they last.
Size: XX-Large, Color: 3 Pack-black, Dark Gray, Khaki
A good quality t-shirts. Very flexible and breathable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2026
M
Verified Purchase
Ms Robertson
Carnegie, US
★★★★★ 4
Fabric is nice
Size: X-Large, Color: 3 Pack-black, Dark Gray, Sky Blue
I got these shirts for my friend , and he likes the fabric. The only thing is the neck shrinks so wash it in cold.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 17, 2026
T
Verified Purchase
Theresa
San Leandro, US
★★★★★ 5
Good quality
Size: Large, Color: 3 Pack-black, Dark Gray, Navy Blue
Very soft and they look nice
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 8, 2026

recommand products