SKU: 94575585097

Human FGL1, hFc tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human FGL1, hFc tagProduct Specification Species Human Synonyms Fibrinogen like protein 1, HP 041, Hepassocin (HPS), Hepatocyte derived fibrinogen related protein 1 (HFREP 1), Liver fibrinogen related protein 1 (LFIRE 1), HFREP1 Accession Q08830 Amino Acid Sequence Protein sequence (Q08830, Leu23 Ile312, with C hFc tag)

Product Specification


Species Human
Synonyms Fibrinogen-like protein 1, HP-041, Hepassocin (HPS), Hepatocyte-derived fibrinogen-related protein 1 (HFREP-1), Liver fibrinogen-related protein 1 (LFIRE-1), HFREP1
Accession Q08830
Amino Acid Sequence

Protein sequence (Q08830, Leu23-Ile312, with C-hFc tag) LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI

Expression System HEK293
Molecular Weight

Predicted MW: 60.1 kDa Observed MW: 60 kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Tag with C-hFc tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Fibrinogen-like protein 1 (FGL-1) is a protein that is structurally related to fibrinogen. In humans, FGL-1 is encoded by the FGL1 gene. Four splice variants exist for this gene. FGL1 is a member of the fibrinogen family of proteins, which also includes fibrinogen, fibrinogen-like protein 2, and clotting factors V, VIII, and XIII. FGL-1 is homologous to the carboxy terminus of the fibrinogen beta- and gamma- subunits which contains the four conserved cysteines of that are common to all members of the fibrinogen family. However, FGL-1 lacks the platelet-binding site, cross-linking region, and thrombin-sensitive site which allow the other members of the fibrinogen family to aid in fibrin clot formation. FGL-1 has also been observed to strongly bind to and activate LAG-3, a regulatory protein expressed on T cells. As LAG-3 has an important role in controlling activated T cells, manipulating FGL-1 binding to T cells has been proposed for both cancer immunotherapy and anti-inflammatory treatments.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 94575585097

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
DJ SINGH
Fort Morgan, US
★★★★★ 5
good
Size: 23.6 Inch, Color: White
I recently added this bathroom shelf, and it’s been a great upgrade for organizing my space. It was easy to install and feels sturdy enough to hold everyday essentials like toiletries, skincare products, and small containers without any issues. The design is simple and clean, which helps it blend in nicely with the rest of the bathroom. It doesn’t take up much space but still provides enough storage to reduce clutter around the sink or shower area. One thing I appreciate is how practical it is for small bathrooms—everything is within reach, and it makes the space feel more organized overall. As long as it’s installed properly, it holds up well and stays secure. The only downside is that heavier items might not be ideal depending on the material, but for regular use, it does the job perfectly. Overall, a functional and affordable solution if you’re looking to add extra storage and keep your bathroom tidy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
A
Verified Purchase
Ashlee
Lake Worth, US
★★★★★ 5
Perfect!!
Size: 23.6 Inch, Color: Rustic Brown, Size: 23.6 Inch, Color: Rustic Brown
Easy to hang and stunning!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
A
Verified Purchase
Amber
Battle Creek, US
★★★★★ 5
Good quality shelves
Size: 23.6 Inch, Color: White, Size: 23.6 Inch, Color: White
Very good quality. Easy to install. Love them in my bathroom.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
S
Verified Purchase
soma
Dallas, US
★★★★★ 4
Very spacious and beautiful
Size: 23.6 Inch, Color: White, Size: 23.6 Inch, Color: White
A lot of my books fit on here and there’s still more room left if I wanted to buy more books. It’s a simple looking bookshelf but it’s really pretty. It’s also sturdy the only reason I gave it a 4 stars instead of 5 was because it comes with its own plastic screw anchors and they are crap. The shelves were wobbly when we installed them using the plastic screw anchors that came with the packaging. My dad set mine up and luckily he had a bunch of his own so he switched them out with better screw anchors. Once we made that switch it was perfect, there was no wobble or shaking at all. So that’s my only piece of advice. Besides for the screw anchors everything else is perfect
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 25, 2024
B
Verified Purchase
BWW
Natrona Heights, US
★★★★★ 5
Easy to install
Size: 23.6 Inch, Color: White
Super easy to install. I use different wall anchors. The anchors like all anchors that come with shelves are not great. The shelves look very clean on the wall.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 31, 2026

recommand products