SKU: 90921579745

Human CD151 Protein, His tag

Sale price$189.00 Regular price$210.00
Save 10%

Pay in installments of $52.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD151 Protein, His tagProduct Specification Species Human Synonyms CD151 antigen, GP27, Membrane glycoprotein SFA 1, Platelet endothelial tetraspan antigen 3 (PETA 3), Tetraspanin 24 (Tspan 24), TSPAN24 Accession P48509 Amino Acid Sequence Protein sequence (P48509, Try115 Arg221, with C His tag) YQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLR Expression System HEK293 Molecular Weight Predicted MW: 13. 9 kDa

Product Specification


Species Human
Synonyms CD151 antigen, GP27, Membrane glycoprotein SFA-1, Platelet-endothelial tetraspan antigen 3 (PETA-3), Tetraspanin-24 (Tspan-24), TSPAN24
Accession P48509
Amino Acid Sequence

Protein sequence (P48509, Try115-Arg221, with C-His tag) YQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLR

Expression System HEK293
Molecular Weight Predicted MW: 13.9 kDa Observed MW: 17-20 kDa
Purity >90% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CD151 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. CD151 is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. This protein enhances cell motility, invasion and metastasis of cancer cells. Abnormalities in CD151 have been implicated in a form of epidermolysis bullosa.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90921579745

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Lana Maria
Carnegie, US
★★★★★ 1
Plastic not stainless steel
Absolutely awful not stainless steel but plastic that breaks. Do not waste your money
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 14, 2026
A
Amazon Customer
Bozeman, US
★★★★★ 4
Keeps the Sink Area Neat and Organized
This has been really helpful for keeping my sink area clean. The soap dispenser pumps great! The sponge and brush holders keep everything off the counter so that really helps. The stainless steel looks nice and hasn’t shown any rust so far. It’s compact but holds everything I use daily, and cleaning it is easy. Great little upgrade if your sink area always feels messy. edited to add: took me about 45 minutes to finally get the sticker label off it was stuck directly on the stainless steel so I had to be really careful peelng it off
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 12, 2025
S
SoCoGal
Boise, US
★★★★★ 5
Stainless Steel 3-in-1 Sponge/Brush Holder with soap dispenser for Kitchen
This is an ideal item to organize your sink areas. Perfect for kichens but also for bathroom use. I love the built in soap dispenser. The one I currently have doesn't have a dispenser. And the big liquid soap container is always falling over. Mine irack is bigger but this one is more organied. Easy to clean. stainless steel. Smaller foot print so it sits right near the faucet easily. 7.3"L x 5.3"W x 6.5"H And, it has drainage holes in the front rack to keep your sponges fresh by quickly drying. I was going to put this in one of our smaller kitchens in a guest house, but I may just snag it for my kitchen! Good value. Priced right.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 9, 2025
N
Verified Purchase
Nancy
New York, US
★★★★★ 2
Sticky wicket!!
This product arrived as described with one exception. There is a label on the front with a sheer plastic covering which mostly comes off, however the paper and adhesive remaining defy every solvent known to man!!! It has been soaked (twice) in Goo Gone, twice in rubbing alcohol, once in stainless steel cleaner and three times in Dawn power wash.....It remains.... I'd go after it with a razor blade, but I don't want to scratch the stainless.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 14, 2025
J
Verified Purchase
jeanette Rojas
New York, US
★★★★★ 5
Very practical good quality
Color: Silver
Literal: “Good quality, very functional
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 30, 2025

recommand products