SKU: 10720946152

Human CD45, His tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD45, His tagProduct Specification Species Human Synonyms Leukocyte common antigen (L CA), T200, CD45 Accession P08575 Amino Acid Sequence Protein sequence (P08575, Gln26 Gly100, with C 10*His) QSPTPSPTGLTTAKMPSVPLSSDPLPTHTTAFSPASTFERENDFSETTTSLSPDNTSTQVSPDSLDNASAFNTTGGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 9. 5 kDa Observed MW: 55 72 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical Appearance Lyophilized

Product Specification


Species Human
Synonyms Leukocyte common antigen (L-CA), T200, CD45
Accession P08575
Amino Acid Sequence

Protein sequence (P08575, Gln26-Gly100, with C-10*His) QSPTPSPTGLTTAKMPSVPLSSDPLPTHTTAFSPASTFERENDFSETTTSLSPDNTSTQVSPDSLDNASAFNTTGGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 9.5 kDa Observed MW: 55-72 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD45 is a member of the protein tyrosine phosphatase (PTP) family. CD45 contains an extracellular domain, a single transmembrane segment, and two tandem intracytoplasmic catalytic domains, and thus belongs to the receptor type PTP family. CD45 is a type I transmembrane protein that is present in various isoforms on all differentiated hematopoietic cells (except erythrocytes and plasma cells). CD45 has been shown to be an essential regulator of T- and B-cell antigen receptor signalling. It functions through either direct interaction with components of the antigen receptor complexes via its extracellular domain (a form of co-stimulation), or by activating various Src family kinases required for the antigen receptor signaling via its cytoplasmic domain. CD45 also suppresses JAK kinases, and so functions as a negative regulator of cytokine receptor signaling. CD45 does not colocalize with lipid rafts on murine and human non-transformed hematopoietic cells, but CD45 positioning within lipid rafts is modified during their oncogenic transformation to acute myeloid leukemia. CD45 colocalizes with lipid rafts on AML cells, which contributes to elevated GM-CSF signal intensity involved in proliferation of leukemic cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 10720946152

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
LP
Omaha, US
★★★★★ 5
VERY SOFT; MY DOG’S ALREADY APPROPRIATED IT
Color: 01 Off White, Size: Twin (60" x 80")
You know a blanket’s soft when my dog immediately tries to appropriate it. This is incredibly soft, and actually pretty light; it makes for a good spring or summer blanket, or a throw in addition to something else in colder weather. (The twin is big enough that you can double it up over yourself to make it thicker in colder months.) I’m not sure while it’s called a “bubble” blanket - there is a very gentle egg crate shape to it, but it’s not rigid at all, and not dual-layer or filled with air or anything. It’s a very comfy throw (my dog can also attest to that) and for ~$20 (at the time of this review), it’s a great deal. I haven’t noticed any shedding, either, but I’m going to wash it on as gentle a cycle I can, to be safe.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
I
Verified Purchase
Isabel Cristina Prince
Lowell, US
★★★★★ 5
This Blanket Feels Like a Warm Hug 🖤”
Size: Throw50" x 60", Color: Black, Size: Throw50" x 60", Color: Black
This faux fur throw blanket is incredibly soft and cozy, making it perfect for relaxing on the couch or adding extra warmth to a bed. The fluffy texture feels plush and comfortable, while the dark color gives it a modern and elegant look. I like how it instantly makes the space feel more inviting and stylish. It’s lightweight enough for everyday use but still feels warm and comfortable during cooler evenings. The material also looks beautiful draped over furniture as part of the décor. Overall, it’s a great decorative and functional blanket for anyone looking to add comfort and a cozy touch to their living space.”
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
W
Verified Purchase
Wendy Ferrie
Lake Worth, US
★★★★★ 5
Absolutely Luxurious, Mushu-Approved, and Easy to Care For!
Size: Throw50" x 60", Color: Pink, Size: Throw50" x 60", Color: Pink
​I am absolutely thrilled with this faux fur blanket! From the moment I pulled it out of the packaging, the quality was immediately apparent. The fur is incredibly plush, thick, and unbelievably soft, it truly feels like wrapping up in a cloud. It's the perfect weight, too: cozy on a chilly evening, but not stifling. ​What really sets this blanket apart is the quality and durability. I can confirm that this blanket does not pill, which is a huge bonus. Even better, it holds up perfectly in the wash. I've washed it several times now, and there has been zero shedding, either in the washer/dryer or after it comes out. It remains just as soft, fluffy, and luxurious as the day I bought it, making maintenance incredibly easy. ​But the real testament to this blanket's quality comes from my dog, Mushu! I bought it for myself, but it has quickly become his favorite spot in the house. If he's not actively on a walk or eating, you can guarantee he's curled up on "the fuzzy blanket," completely buried in the softness. ​If you're looking for a blanket that is the definition of comfort, luxury, and warmth, and is also durable and holds up perfectly to washing, look no further. This is a must buy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 11, 2025
F
Verified Purchase
Felicia
Battle Creek, US
★★★★★ 5
Soft and cozy!
Size: Throw50" x 60", Color: Teal
My daughter loves it. The quality is good. The color is vibrant!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
V
Verified Purchase
Vandalay Industries
Carnegie, US
★★★★★ 4
Beautiful color, super soft and shaggy!
Size: Throw50" x 60", Color: Olive Green, Size: Throw50" x 60", Color: Olive Green
This throw was purchased for the bed of a 15 year old who is going for a cozy, earthy aesthetic in his room. This throw is a deep rich green. It reminds me of grass with the length of the shag and of moss with the color. The back side of the blanket is smooth and soft. It is worth noting that depending on how the blanket lays, you can see the fabric underneath as the fibers part. (See photo.) It laundered well in the washing machine. There was no color bleeding or shedding. I dried it in the dryer on extra low. The fibers didn't pill or knot like fleece does. (All of the photos were taken after laundering.) I am very happy with the throw it adds texture and depth to the bed. I would purchase this item again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 20, 2026

recommand products