SKU: 11130877600

Ephrin B3 Fc Chimera Protein, Human

Sale price$225.00 Regular price$250.00
Save 10%

Pay in installments of $62.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 7 - Sep 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Ephrin B3 Fc Chimera Protein, HumanProduct Specification Species Human Accession Q15768 Amino Acid Sequence Leu28 Ser224, with C terminal Human IgG Fc

Product Specification


Species Human
Accession Q15768
Amino Acid Sequence

Leu28-Ser224, with C-terminal Human IgG Fc

LSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPNYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSLEPGKENLPGDPTSNATSRGAEGPLPPPSIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 60-65kDa (Reducing)
Purity

>95% by SDS-PAGE&RP-HPLC

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

 Ephrin-B3 binds HSPGs on HEK-293T, HeLa, and CHO cells, where heparin blocks binding to HEK-293T cells independently of Eph receptors, and a heparin/HS-binding domain in ephrin-B3 was identified outside of the Eph-receptors binding domain. The two positively charged residues, Arg178 and Lys179, in the ephrin-B3's juxtamembrane region is important for heparin/HS binding. Changing the corresponding amino acids in the non-heparin binding ephrin-B1 to positively charged residues gave heparin binding. Ephrin-A3 also binds HS, where Lys176 corresponds to Lys179 in ephrin-B3. Ephrin-B3 binding to lymphocytes and lymphoma cell lines may also depend on other residues near the transmembrane domain, in particular Arg188 which is less affected by heparin, suggesting several mechanisms for ephrin-B3 binding to cells. Functional studies revealed that ephrin-B3 binding to cells induces signaling, influencing both cell rounding and spreading.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 11130877600

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Bobbie
Dallas, US
★★★★★ 1
“Indestructible”? Not even close.
Color: Carrot Orange, Color: Carrot Orange
I bought this because it was advertised for large aggressive chewers and claimed to be indestructible. Unfortunately, that couldn’t be further from the truth. My dog destroyed this toy in about two minutes. Seriously. It took me longer to get it out of the Amazon packaging and the manufacturer’s box than it did for my dog to rip it open. Once he got going, the seams popped and stuffing was everywhere. Then I got the joy of cleaning up the mess, which took longer than the toy lasted. If your dog is actually a strong chewer, this toy probably won’t survive very long. I wish I could recommend it, but honestly it just didn’t hold up at all. Save your money and keep looking
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 12, 2026
R
Verified Purchase
rdb
Boise, US
★★★★★ 5
UPDATE TO MY REVIEW / It's NOT indestructible!
Color: Carrot Orange
UPDATE: I stand by my review for the original "Plush Toy". BUT ... the seller contacted me and offered to help, because they don't want their customers to be unhappy with their products. I described the problem, and they said they'd contact their supplier to correct things. AND ... they offered to send another dog toy that actually was indestructible. My dog, a Border Collie - Retriever mix, loved the replacement they sent, an Orange Peanut. (He even took it to bed the first night.) This was much appreciated. But what I most appreciated was their Customer Service and Care. They don't just say they want their customers to be happy, they actually demonstrate it by their actions. This type of care is rare these days, and I commend them for it. Notice I've changed my rating from 1-star to 5-stars, this is in recognition of their Customer Service. To me, this type of care is more important than any product. So I now fully endorse this seller. If you have an issue with a product, just contact them (through Amazon), and they will do their utmost to make things right, and to make sure you're happy. ****************************************** I bought this because it was described as "Dog Plush Toy for Large Aggressive Chewers, Indestructible Dog Squeaky Toy" (from their listing on Amazon). My dog is a Golden Retriever mix, and he's only a "medium size aggressive chewer". And yet, this toy lasted 10 minutes at the most. Very disappointing ... save yourself a "dog toy heartbreak".
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2023
M
Verified Purchase
Mistelle Lanko
Dallas, US
★★★★★ 3
Not indestructible however not terrible.
Color: Shocking Pink
Not indestructible however not terrible. My strong chewer had quickly devoured the plush stomach and eaten the squeaker. But the rope parts and rough face pieces are holding up well. Not a disaster.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2026
C
Verified Purchase
Chris
San Leandro, US
★★★★★ 4
Good toy but not indestructible
Color: Royal Blue
The toy is nice, but my dog killed it in about 30 minutes. The only reason I didn’t give it five stars is because it says indestructible Toy in the description. Other than that it is a nice chew toy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 6, 2026
J
Verified Purchase
J. L.
Whiting, US
★★★★★ 5
Dog loves it. So 5 starts
Color: Carrot Orange
A great value toy that is very hard to destroy. Our dog usually runs through softer toys and this one has lasted a long time. Its not chewable like a plushy but harder fabric that doesn't rip apart. The dogs are having a blast with it. And so are we. The colors fit the description. The size was idk 2ft ish. It met all expectations. I wouldn't expect to need more than one of them unless your dog is a super destroyer.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 27, 2025

recommand products