SKU: 12523567104

GIPR Fc Chimera Protein, Human

Sale price$342.00 Regular price$380.00
Save 10%

Pay in installments of $95.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 8 - Sep 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

GIPR Fc Chimera Protein, HumanProduct Specification Species Human Accession P48546 1 Amino Acid Sequence Arg22 Gln138, with C terminal Human IgG Fc

Product Specification


Species Human
Accession P48546-1
Amino Acid Sequence Arg22-Gln138, with C-terminal Human IgG Fc RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Expression System HEK293
Molecular Weight 45-54kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Glucose-dependent insulinotropic polypeptide receptor (GIPR) are G protein-coupled receptors belonging to the secretin receptor super-family, also known as class B1. GIPR comprises an N-terminal extracellular domain (ECD), a central domain consisting of seven transmembrane α-helices, and a C-terminal, cytoplasmic domain that mediates intracellular signal transduction by physical association with the G protein. GIPR increases insulin secretion in hyperglycemia and stimulates glucagon release in hypoglycemia. It also plays an important role in adipogenesis, islet β cell proliferation and insulin release, and is associated with type 2 diabetes, obesity and neurodegenerative diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 12523567104

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
O
Verified Purchase
Onceuponatime
Natrona Heights, US
★★★★★ 5
So sweet and nostalgic!
Format: Hardcover
Love, love, love this book as an adult. What great memories it brings back, so many specific ones are included. My grandkids love it too, "That's just what we do!", they say excitedly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2024
L
Verified Purchase
Lisa Plancich
Waukegan, US
★★★★★ 5
Everyone Can Use A Little Assistance With Manners
Format: Hardcover
"Manners Can Be Fun" covers basics like introductions, please and thank you, being responsible in the home you live in and table manners. It's the illustrations, however, which get the point across and hit the reader over the head. No matter your age, the cute drawings really let one see what others experience when you behave badly. The basics of what's important in life are put into perspective and appreciated all over again. Playing, saying "hello" and so many other topics pertinent to etiquette and consideration are placed on Mr. Leaf's pages in quick, precise prose which encourage action. Munro Leaf's description of The Noisey's, The Pigs, Me First, Whineys, Smash, Rip, Ruin and others assist young and old of what to do around others and what not to do. It's basic, it's short and sweet, it's truly a classic. Like all classics, "Manners Can Be Fun" has not gone out of style. Many thanks to Universe Publishing for placing this wonderful book back on the shelves and into our hands.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 29, 2010
T
Verified Purchase
Texas
Cuba, US
★★★★★ 5
A classic for the kids in your family.
Format: Hardcover
This is a classic book of manners written for youngsters. I had a copy a copy when I was a child, read it to my children, gave it to my grandchildren and purchased this copy for my great grandchildren. Necessary lessons are presented simply with illustrations one won’t forget. The lesson I remember most is this: “Be kind to animals. They have feelings too.” Most highly recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 16, 2022
A
Verified Purchase
AF
Fort Morgan, US
★★★★★ 5
Great message that the kids listen to
Format: Hardcover
I love the message and my kids (3 and 5) find it credible and engaging, so it's a win all around. I find the illustrations (which are either done by a 5 year old or an adult as talented an artist as I am) painful but I give the text 6 out of 5 stars so when I take a star off for the over-the-top illustrations we're still at 5/5 ;) Kids who have greater access to exclusively modern media with intense graphics may not be able to relate to the material: the graphics are a big hurdle and the text is pretty dated too. I'm sure an updated version would be even more engaging for my kids but what it lacks in exciting, current graphics it makes up for in specificity and clarity for my two.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 11, 2015
N
Verified Purchase
Northcoast Neighbor
New York, US
★★★★★ 5
Entertaining and helpful lessons
Format: Hardcover
My family loves this book. Used to read it to my daughter as a young girl and now she’s a teen. We still talk about the lessons learned in this book! The characters and illustrations crack me up: Smash, rip and ruin taught us a lot! And the ones without hands and noses! I couldn’t believe how long ago this book was written when we got it- all lessons still applicable today.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 22, 2020

recommand products