SKU: 12543450738

Mouse CD152, his tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 18 - Sep 23

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CD152, his tagProduct Specification Species Mouse Synonyms Cytotoxic T lymphocyte associated antigen 4 (CTLA 4), Cd152 Accession P09793 Amino Acid Sequence Protein sequence (P09793, Glu36 Asp161, with C 10*His) EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 15. 6 kDa Observed MW: 20 30 kDa Purity 95% by SDS PAGE Tag

Product Specification


Species Mouse
Synonyms Cytotoxic T-lymphocyte-associated antigen 4 (CTLA-4), Cd152
Accession P09793
Amino Acid Sequence

Protein sequence (P09793, Glu36-Asp161, with C-10*His) EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 15.6 kDa Observed MW: 20-30 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CTLA-4 or CTLA4 (cytotoxic T-lymphocyte-associated protein 4), also known as CD152 (cluster of differentiation 152), is a protein receptor that functions as an immune checkpoint and downregulates immune responses. CTLA-4 is constitutively expressed in regulatory T cells but only upregulated in conventional T cells after activation – a phenomenon which is particularly notable in cancers. It acts as an "off" switch when bound to CD80 or CD86 on the surface of antigen-presenting cells. The CTLA-4 protein is encoded by the Ctla-4 gene in mice and the CTLA-4 gene in humans.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 12543450738

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Shanna Clark
Whiting, US
★★★★★ 5
So cute
Color: Blue, Color: Blue
These are so soft and fuzzy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
S
Verified Purchase
sarah
Fort Morgan, US
★★★★★ 5
Soft & fluffy. Stuffy arm rest.
Color: Purple, Color: Purple
Soft and fluffy & my fav color purps. Now I'm looking for other purple accessories to go with my 2021 Honda CRV. I don't think this cover would be be enough for a large SUV arm rest such as a Navigator... But yea, order if you want some color & funk in the ride
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 25, 2026
A
Verified Purchase
Amy
Draper, US
★★★★★ 1
Return refund impossible to receive also it’s tacky looking
Color: Black
First off this item said it was fit, but it did not second of all I went to return it and they could only be returned to the original payment method my credit card. My bank is not showing anything. Amazon is zero help trying to say it went back on a gift balance, which I have photo proof that both are incorrect. I tried to reach out to the seller and they were also zero help so I advise one not to buy this because it’s small and cheap looking too you can’t get your refund back.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 30, 2025
B
Verified Purchase
Biff Worthington
Los Angeles, US
★★★★★ 4
It’s so so but ok
Color: Champagne
The color is good and the hair is not as silky as my car seat or seatbelt covers. Also the hairs really get matted. It may just be from elbows but it gets so matted it is hard to undo. And when you do get it good it happens right again and frankly looks bad and unkempt. Other than that it fits right and is more comfy than original so I leave it on. Even with vacuum at car wash the mats stay so it seems eventually it will be too much. I have had it about a month. Maybe a shorter pile is a better option for armrest, like shearling pile. I’ll try that when this one is too far gone. It wasn’t expensive and is still worth the money to not have a blazing hot armrest so I m good for now.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026
S
Verified Purchase
shari morgan
Boise, US
★★★★★ 3
🙂‍↔️
Color: Light Pink, Color: Light Pink
The color is beautiful. Is soft, but it runs very short doesn’t fit my car. I’ve had it for six months and now it looks like a dirty dog lol
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 17, 2026

recommand products