Pay in installments of $80.25 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 27 - Oct 2
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Galectin-9 His Tag Protein, HumanProduct Specification Species Human Antigen Galectin 9 Synonyms Gal 9, Ecalectin, Tumor antigen HOM HD 21 Accession O00182 2 Amino Acid Sequence Ala2 Thr323, with N terminal 8* His
Product Specification
| Species | Human |
| Antigen | Galectin-9 |
| Synonyms | Gal-9, Ecalectin, Tumor antigen HOM-HD-21 |
| Accession | O00182-2 |
| Amino Acid Sequence |
Ala2-Thr323, with N-terminal 8* His HHHHHHHHAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT |
| Expression System | HEK293 |
| Molecular Weight | 47-55kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
2.Nishi N., Itoh A., Fujiyama A., Yoshida N., Araya S.-i., Hirashima M.,Shoji H., Nakamura T. Development of highly stable galectins: Truncation of thelinker peptide confers protease-resistance on tandem-repeat type galectins.FEBS Lett. 2005;579:2058–2064. 3.Oomizu S., Arikawa T., Niki T., Kadowaki T., Ueno M., Nishi N., Yamauchi A., HirashimaM. Galectin-9 suppresses Th17 cell development in an IL-2-dependent butTim-3-independent manner. Clin. Immunol. 2012;143:51–58. d 4.Bozorgmehr N., Mashhouri S., Perez Rosero E., Xu L., Shahbaz S., Sligl W.,Osman M., Kutsogiannis D.J., MacIntyre E., O’Neil C.R., et al. Galectin-9, aPlayer in Cytokine Release Syndrome and a Surrogate Diagnostic Biomarker inSARS-CoV-2 Infection. mBio. 2021;12:e00384-21. |
Background
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy