SKU: 16093208175

Human ApoE2 Protein, His Tag

Sale price$108.00 Regular price$120.00
Save 10%

Pay in installments of $30.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human ApoE2 Protein, His TagProduct Specification Species Human Synonyms Apolipoprotein E, Apo E, APOE Accession P02649 Amino Acid Sequence Protein sequence (P02649, Lys19 His317(Arg176Cys), with C His Tag)

Product Specification


Species Human
Synonyms Apolipoprotein E, Apo-E, APOE
Accession P02649
Amino Acid Sequence

Protein sequence (P02649, Lys19-His317(Arg176Cys), with C-His Tag) KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKCLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH

Expression System HEK293
Molecular Weight Predicted MW: 35.9 kDa Observed MW: 35-40 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, pH8.0 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

The APOE2 protein is one of three major isoforms (E2, E3, E4) of apolipoprotein E (APOE), a key lipid transport protein involved in cholesterol metabolism and neuronal repair. Encoded by the APOE gene, APOE2 differs from the most common isoform (APOE3) by a cysteine-for-arginine substitution at position 158 (Cys158Arg), altering its structure and receptor-binding affinity. While APOE2 is associated with a reduced risk of late-onset Alzheimer’s disease (AD) compared to APOE4, homozygous carriers may develop type III hyperlipoproteinemia, a lipid disorder. APOE2 exhibits weaker binding to LDL receptors, impairing clearance of triglyceride-rich lipoproteins. Its neuroprotective effects in AD may stem from enhanced amyloid-β clearance and anti-inflammatory properties.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 16093208175

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Reviews by Christopher
Belleville, US
★★★★★ 5
Keeps things organized
Color: Clear
These are worth buying. They can store so many things. We are using it for our vanities, and they work amazingly. They are super sturdy, and the clear plastic gives them a clean look. These are very helpful to have.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 5, 2026
S
Verified Purchase
shjen
Carnegie, US
★★★★★ 5
nice set
Color: Clear Black
I bought this set to organize a messy desk drawer and it made a huge difference right away. Having multiple sizes in one pack is what really makes this set useful. I was able to customize the layout instead of trying to force everything into a few fixed compartments. The trays feel sturdy enough for everyday use and the clear design makes it easy to see everything at a glance. I used them for things like pens, paper clips, chargers, and random small items that usually get lost, and now everything actually has a place. They also don’t slide around much once placed, especially if the drawer is fairly full, which I appreciated. Setup took just a few minutes and instantly made the space look cleaner and more put together. If I had to note anything, the plastic is lightweight, so it is not heavy duty, but for organizing office supplies it works perfectly fine. Overall, a really practical set that helps you stay organized without overthinking it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026
E
Verified Purchase
Emily McNutt
Phoenix, US
★★★★★ 4
Great organizers!
Color: Clear
This is a really practical organizer set. I used it in my bathroom and nightstand drawers, and it helped clean everything up fast. The different sizes are the best part—you can mix and match depending on what you’re storing. Only reason I’m giving 4 stars is because the plastic isn’t super heavy-duty, but it’s still perfectly fine for everyday use. Good value for the amount you get.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2026
A
Verified Purchase
Amazon Customer
Belleville, US
★★★★★ 5
Nice drawer organizers with a lot of versatility.
Color: Clear
I bought these to organize my desk drawer because it seems like I can never find anything I'm looking for without taking everything out first,which is always a pain,so I thought why not try a set of drawer organizers.Talk about night and day,these things keep all my stuff tidy and easy to find now,it's great! The plastic doesn't feel cheap either and the different sizes are very versatile,they also come with enough rubber feet for all the containers,though you do have to peel and stick them on yourself,but it's easy and the adhesive feels very strong. I would definitely recommend these if you're looking for some great containers to get things more organized.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 23, 2026
K
Verified Purchase
Kirbyjakobs
Louisville, US
★★★★★ 5
Easy to configure. So helpful!
Color: Clear, Color: Clear
My house has old bathroom cabinets that are too narrow for most organizers I have found. These organizers come in different sizes so I can mix and match the pieces to fit the drawers and items I have to store. I have filled two drawers with these and still have more containers to use. These are truly the tool for the job. They are sturdy, stable and I thought I would have trouble with them moving around but they stay in place while maintaining their versatility. If I need to switch out stuff, I just reconfigure the drawer. No assembly required. One of my most favorite simple purchases. I can’t believe I have lived without these simple but helpful organizers!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 8, 2026

recommand products