SKU: 16216972906

Human SV2A Protein, His Tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Oct 8 - Oct 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human SV2A Protein, His TagProduct Specification Species Human Synonyms Synaptic vesicle glycoprotein 2A, KIAA0736 Accession Q7L0J3 Amino Acid Sequence Protein sequence (Q7L0J3, Try480 Thr590, with C His Tag) YASRTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCTFINTVFYNTDLFEYKFVNSRLINSTFLHNKEGCPLDVTGT Expression System HEK293 Molecular Weight Predicted MW: 14. 7 kDa Observed MW: 25 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Physical

Product Specification


Species Human
Synonyms Synaptic vesicle glycoprotein 2A, KIAA0736
Accession Q7L0J3
Amino Acid Sequence

Protein sequence (Q7L0J3, Try480-Thr590, with C-His Tag) YASRTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCTFINTVFYNTDLFEYKFVNSRLINSTFLHNKEGCPLDVTGT

Expression System HEK293
Molecular Weight Predicted MW: 14.7 kDa Observed MW: 25 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Synaptic Vesicle Glycoprotein 2A (SV2A) is a membrane protein found in all synaptic vesicles, the organelles responsible for storing neurotransmitters in neurons. It is the ubiquitous and primary isoform of the SV2 family. SV2A plays a critical role in regulating the exocytotic release of neurotransmitters. It is essential for priming synaptic vesicles, a process that makes them ready for calcium-triggered fusion with the presynaptic membrane. It is the direct molecular target for the anti-epileptic drug levetiracetam, underscoring its therapeutic significance in modulating neuronal excitability.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 16216972906

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
G.L.K.
Port Orchard, US
★★★★★ 4
Useful with some scientific corroboration
Format: Paperback
Worth it as a primer to slide content and how it inter-relates to the delivery when giving a presentation. Very slightly laboured, like most TV documentaries nowadays - you feel they could move a bit faster (...yeah we got it the first time).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 9, 2012
T
Verified Purchase
Terry
Cuba, US
★★★★★ 5
Simple and streamlined to meet anyone's needs
Format: Paperback
This book rocks! It provide a simple and structured way to define, develop and deliver a "Kick Ass" presentation that you can project or just use from the podium. It bring the audio and visual together to compliment a story to be shared. It has taken the hassel factor out of designing a presentation for anyone on any subject. Thank you!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 11, 2014
M
Verified Purchase
Mack90
Grantham, US
★★★★★ 2
Lasting value but degraded presentation
Format: Paperback
I've been a BBP fan since the first edition in 2005. The second edition in 2007 was a significant update and refinement. The latest, 2011 edition, is not worth buying if you already have the second edition -- the information is essentially the same but the 2011 is printed on cheap paper and the contrast between text and background for most of the illustrations is lousy, e.g. black text on a dark grey background, white text on a light grey background. I found it very difficult to read. The online version (O'Reilly Safari Books OnLine) is slightly better because it allows you to magnify the low contrast images which makes them slightly more legible. Thankfully, access to the online version is included with the ink-on-paper book free via a scratch-off, lottery ticket-type insert at the back of the book. If I had to do it again, I'd skip the paper book from Amazon and just purchase electronic access via O'Reilly. This version is more legible and you can print important pages that you might want hard copies of to highlight, mark-up, etc.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 18, 2011
K
Verified Purchase
Kevin
Phoenix, US
★★★★★ 4
Powerful for the presenter
Format: Paperback
My boss's boss recently told me that our organization's presentations are boring data dumps that make her wish she was somewhere other than there listening but not really hearing or caring about this slide and dreading the next. She suggested that since I was going to be doing a lot of presentations in the future I should avoid that method and do better presentations. I immediately sought advice from our best presenter and learned that his method came from his gut feelings about what worked better. He has good instincts but to codify what he explained I decided to buy a book to learn why his approach works. The closest book with an effective explanation I could find is "beyond bullet points". It captured and expanded on the instinct my new mentor explained so that I could now understand how to use the slides to supplement the story and how to interweave the data so the whole presentation is more meaningful and memorable. I recommend this book to anyone looking for more of an answer on how to improve their presentations and eliminate the data dump in bullet points.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2014
A
Verified Purchase
Antoinette Waikiki
Grantham, US
★★★★★ 5
Good purchase and superb seller.
Format: Paperback
This is a very good book. I was very satisfied with the service I received, I got the book before the expected time. I was really supprised with the shape of the book...it was a used book but looked like brand new. I say this was superb purchase and the seller was top notch.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 4, 2013

recommand products