SKU: 17589458162

Human CKM, His tag

Sale price$101.25 Regular price$112.50
Save 10%

Pay in installments of $28.12 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 3 - Sep 8

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CKM, His tagProduct Specification Species Human Synonyms Creatine kinase M chain, Creatine phosphokinase M type (CPK M), M CK, CKMM Accession P06732 Amino Acid Sequence Protein sequence (P06732, Met1 Lys381, with C 10*His)

Product Specification


Species Human
Synonyms Creatine kinase M chain, Creatine phosphokinase M-type (CPK-M), M-CK, CKMM
Accession P06732
Amino Acid Sequence

Protein sequence (P06732, Met1-Lys381, with C-10*His) MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 44.8 kDa Observed MW: 45, 50 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Creatine kinase, muscle also known as MCK is a creatine kinase. The protein is a cytoplasmic enzyme involved in cellular energy homeostasis. The protein reversibly catalyzes the transfer of "energy-rich" phosphate between ATP and creatine and between phospho-creatine and ADP. Its functional entity is a MM-CK homodimer in striated (sarcomeric) skeletal and cardiac muscle. In heart, in addition to the MM-CK homodimer, also the heterodimer MB-CK consisting of one muscle (M-CK) and one brain-type (B-CK) subunit is expressed. The latter may be an important serum marker for myocardial infarction, if released from damaged myocardial cells into the blood where it can be detected by clinical chemistry.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 17589458162

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Mindhealer
Houston, US
★★★★★ 4
Please read!
Color: Ultra, Size: Large
This dog ball is so useful! We have a large property and we use the Chuckit! thrower with the ball. The color and material of the toy is very high-quality and lasts for a long time. We have been using the Chuckit! brand for a long time now and we love their dog products! It is a good price and we buy replacement balls like once or twice every 6 months because they keep getting lost in bushes or trees 😂 After some time the color of the ball gets washed out and since our dogs are aggressive chewers, one of the balls we got broke and split open, but it was still usable! The reason that one broke is because we had it for a HECKA LONG TIME! It has no squeaker so when your dog has the ball it wont make any loud and annoying sounds. It is easy to pick up with the thrower and it seems durable and sturdy enough to last them a few months. I don't recommend as a cat toy because this ball is specifically designed for dogs. But is your cat likes fetch i guess it could work! The ball is soft enough to not be hard as steel, but is sturdy enough to not break immediately.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 9, 2025
H
Verified Purchase
Hayleysgirl
Fort Morgan, US
★★★★★ 5
Chuck-it stands up to huskies teeth.
Color: Ultra, Size: Large
This item is awesome. Stands up to my huskies teeth.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
R
Verified Purchase
RD
Dallas, US
★★★★★ 5
Great for dogs that love cat toys
Size: Small - 2 Count (Pack of 1)
I have a 45# dog who loves to play with cat toys. She's a strange one, but it's what she likes. She also loves ChuckIt balls (glow in the dark, squeaker, rubber, etc.). We bought 2 2-packs and we're glad we did. These are about the side of ping pong balls or golf balls. Yes, if your dog's an aggressive chewer or smaller than a teacup these will probably not last long. Yes, my weirdo dog almost immediately picked all the "fuzz" off the ball because that's what she does. The quality and durability of the ball haven't been affected, it's just a bald little ball. Highly recommend for any non-aggressive chewers that LOVE cat-sized toys.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 18, 2020
J
Verified Purchase
Jennifer Williams
Waukegan, US
★★★★★ 5
Not very durable
Size: Small - 2 Count (Pack of 1)
I purchased some of these balls a while back and had forgotten how quickly my yorkie puppy was able to destroy them.. I recently ordered some more bc I saw them on sale. I now have another yorkie pup that also loves to play ball. They actually play ball with each other. Within 24 hrs, the balls are fraying and they are getting choked on the fuzzy s off the balls. I'm not going to bother to return 3 2pks bc they were so cheap. Now I know why.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 9, 2023
R
Verified Purchase
RYS
Draper, US
★★★★★ 1
This ball seems to be a counterfeit.
Size: Large - 2 Count ( Pack of 1), Size: Large - 2 Count ( Pack of 1)
This ball seems to be a counterfeit and if it is not, it was made not to be played with by animal or human. In a review I just read, Iduna had posted this: Iduna 1.0 out of 5 stars Only for the most docile of play Reviewed in the United States on March 6, 2024 Size: Large - Pack of 2Verified Purchase I thought it was great that these came in all sizes and bought the large for an urban dog park hoping it would not go through the slats of the fence and bought these as sort of a test before I bought the launcher. While the sizing was great unfortunately each one lasted a little more than half an hour. The rubber sphere part is constructed of two halves and I don't know if there's any sort of sealant between those two halves or if it's just held together by the thin tennis ball type cover but some bouncing off of the turf covered concrete and dog play upon retrieval caused the two rubber halves to separate and a few more tosses led it to quit bouncing and sort of squished together when the dogs grabbed it. That caused the thin tennis ball type material to fray and all was lost. This post was more than true without any exaggeration. Our dog fetched it in the house and tore it up within 5 mins. The original Chuckit launcher and ball was our first purchase thinking that these would be great balls to replace the Launcher ball which actually lasted our dog about 3 months of constant play and grinding on it (He loved that thing). This one came apart very easily as you can see, but the smell of the broken rubber was extremely solvent smelling (like toluene) of which I have good experience with chemicals like it from the industry in which I worked. Industrial solvents are definitely bad for our pets and that is the smell that comes out of this broken ball even at a distance. It filled our kitchen with the stench. I find this rather suspect when the description says: "this toy is designed with an extra-thick natural rubber core". In any case, the ball fell apart quickly and it is not like the launcher ball at all. I coach tennis and a real tennis ball would be better for our dog than this thing. Broken tennis balls don't smell like that at all and they last much longer and cost the same amount for 3 or 4 vs 2.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 17, 2024

recommand products