SKU: 19640895560

ALK-1/ACVRL1 His Tag Protein, Mouse

Sale price$266.40 Regular price$296.00
Save 10%

Pay in installments of $74.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 12 - Sep 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

ALK-1/ACVRL1 His Tag Protein, MouseProduct Specification Species Mouse Synonyms SKR3, Activin receptor like kinase 1 (ALK 1), TGF B superfamily receptor type I (TSR I), Acvrl1, Acvrlk1, Alk 1 Accession Q61288 Amino Acid Sequence Asp23 Pro119, with C terminal 8*His DLAKPSKLVNCTCESPHCKRPFCQGSWCTVVLVREQGRHPQVYRGCGSLNQELCLGRPTEFLNHHCCYRSFCNHNVSLMLEATQTPSEEPEVDAHLPGGGSHHHHHHHH Expression System HEK293 Molecular Weight 23 31kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation

Product Specification


Species Mouse
Synonyms SKR3, Activin receptor-like kinase 1 (ALK-1), TGF-B superfamily receptor type I (TSR-I), Acvrl1, Acvrlk1, Alk-1
Accession Q61288
Amino Acid Sequence

Asp23-Pro119, with C-terminal 8*His DLAKPSKLVNCTCESPHCKRPFCQGSWCTVVLVREQGRHPQVYRGCGSLNQELCLGRPTEFLNHHCCYRSFCNHNVSLMLEATQTPSEEPEVDAHLPGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 23-31kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Cindy Lora Gil. Bruno Larrivée. Alk1 haploinsufficiency causes glomerular dysfunction and microalbuminuria in diabetic mice. Scientific RepoRtS (2020) 10.

Background

The Bone Morphogenetic Protein (BMP) receptor Activin receptor–like kinase 1 (Alk1), which is predominantly expressed in the vascular endothelium, has been shown to play a critical role in angiogenesis. Embryos lacking Alk1 die early during embryonic development due to impaired vascular remodeling and lack of perivascular cell coverage. In renal physiology, Alk1 has been suggested to play an important role in the regulation of extracellular matrix deposition, including collagen type I and fibronectin, and Alk1 heterozygosity has been associated with increased renal fibrosis in a mouse model of obstructive nephropathy, probably due to the decrease in the Alk1/Smad1 antifibrotic/protective signaling in renal fibroblasts.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 19640895560

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Mirella Herrera
West Palm Beach, US
★★★★★ 1
Color
Size: 8, Color: Light Green
El color no es igual que el de la foto... es un color muy bajo y opaco !!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
J
Verified Purchase
Jessica Brave
Whiting, US
★★★★★ 5
Looking so handsome.
Size: 8, Color: Purple, Size: 8, Color: Purple
My son was looking so sharp. I will be buying every color.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 12, 2026
G
Verified Purchase
GWENDOLYN WASHINGTON BLACKMON
Chelsea, US
★★★★★ 5
Good quality
Size: 6, Color: Pink
Good quality
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 1, 2026
A
Alvaro Garcia
Belleville, US
★★★★★ 5
Adorable, well-made suit—perfect for special occasions 🤵✨
This suit exceeded my expectations! The color is beautiful and looks even better in person—perfect for weddings, parties, or any formal event. My son looked so sharp and received so many compliments. The fabric feels lightweight and breathable, which is great for warmer weather. It doesn’t feel stiff or uncomfortable, so he was able to move around easily all day. The set comes with everything you need—the jacket, vest, pants, and tie—making it a great value. I also appreciate the adjustable waistband on the pants, which helped get a better fit. Overall, the suit looks very polished and high-quality without the high price tag. Only small note: since it’s linen, it can wrinkle a bit, so you may want to lightly steam it before wearing. Overall, a fantastic outfit for any formal occasion—definitely recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 21, 2026
J
Jacob Johnson
Cuba, US
★★★★★ 5
Sharp Linen Suit with a Breathable Fit for Summer
Size: 5, Color: Black
This 3-piece suit is a solid option for a summer wedding or any formal event where you want a kid to look sharp without them overheating. The linen material is high quality and feels much more breathable than a standard polyester suit. The jacket, vest, and pants all fit true to size and the stitching is clean throughout. I was impressed with how well the fabric holds its shape without getting excessively wrinkled after a few hours of wear. It’s a grounded, well-made formal set that balances a professional look with the comfort needed for a child to actually move around in it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 17, 2026

recommand products