SKU: 1974062818

Rhesus macaque IFNA13 Protein, His Tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 6 - Sep 11

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rhesus macaque IFNA13 Protein, His TagProduct Specification Species Rhesus macaque Synonyms Interferon, alpha 13 Accession A0A5F8AJA6 Amino Acid Sequence Protein sequence (A0A5F8AJA6, Cys25 Leu182, with C His Tag) CDLPETHSLDNRKTMMLLAQMSRISPSSCLMDRHDFGFPQQEFDGNQFQKAPAISVLHELIQQTFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQQERVGETPLMNADSTLAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSFSLSTNL Expression System HEK293 Molecular Weight Predicted MW: 20 kDa Observed MW: 17 kDa Purity 95% by SDS PAGE Endotoxin <1EU

Product Specification


Species Rhesus macaque
Synonyms Interferon, alpha 13
Accession A0A5F8AJA6
Amino Acid Sequence

Protein sequence (A0A5F8AJA6, Cys25-Leu182, with C-His Tag) CDLPETHSLDNRKTMMLLAQMSRISPSSCLMDRHDFGFPQQEFDGNQFQKAPAISVLHELIQQTFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQQERVGETPLMNADSTLAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSFSLSTNL

Expression System HEK293
Molecular Weight Predicted MW: 20 kDa Observed MW: 17 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

IFNA13, or Interferon Alpha-13, is a member of the type I interferon (IFN) family, a group of cytokines crucial for innate immunity against viral infections. It signals through the shared IFNAR1/IFNAR2 receptor complex to activate the JAK-STAT pathway. This leads to the expression of interferon-stimulated genes (ISGs) that establish an antiviral state in cells. IFNA13 is implicated in the early immune response. Research suggests its expression and potential roles may vary in different pathological contexts, including viral diseases and certain cancers, warranting further investigation into its unique biological activities.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 1974062818

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
DrEAM
Cuba, US
★★★★★ 5
Super soft, runs small, long tail
High quality, super soft, good neck height, nice price, ready to go right out of the dryer, medium thick material, works well under a sport coat or sweat shirt, snug fit--runs about one size small. Length is about four inches too long. So, ideally made for tall and skinny people (I am short and thick), but going one size up works fine for me except have to tuck it in due to the length.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 26, 2025
G
Verified Purchase
Gabriel King
Fort Morgan, US
★★★★★ 5
This shirt is a cheat code
Color: Black, White, Navy Blue, Light Gray, Size: XX-Large
These shirt fits my body so perfectly! I’m 6’5” 310 pounds but I look 260 pounds. I sweat easily and I’m very sensitive to the material a piece of clothing is made of. This shirt is lightweight, extremely breathable, and feels like silk on the skin. It compliments and accentuates my contours to enhance my physique. I only tried on one and I’ve already ordered 12 more hehe. This is a cheat code.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 24, 2025
B
Verified Purchase
bigness
Louisville, US
★★★★★ 4
I Love the collar
Color: Black, White, Navy Blue, Wine Red, Size: Large
Great T-shirt. I can wear this casually with jeans or with a sports coat. The fabric is soft. There is no label in the collar, so you can wear it however you want.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
E
Verified Purchase
Emel Djeipah
Natrona Heights, US
★★★★★ 3
NOT a compression shirt
Color: Black, White, Navy Blue, Wine Red, Size: Large
These are well made with good quality material but are not what I was expecting given the picture. I am an XL and ordered a L because I wanted them to be tight (which they are not.) I decided not to return them because they are good shirts with a reasonable fit, but be advised these are not compression shirts.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
J
Verified Purchase
JIM D. MCGHEE
Boise, US
★★★★★ 5
Ficerd high neck tee / I highly recommend...
Color: Black, White, Dark Gray, Light Gray, Size: Large
Great fit... Comfortable! Didn't shrink in the washer!! Didn't wrinkle up in the dryer!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 16, 2026

recommand products