SKU: 200439936

Human CD9 , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 10 - Sep 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD9 , His tagProduct Specification Species Human Synonyms 5H9 antigen, Cell growth inhibiting gene 2 protein, Leukocyte antigen MIC3, Motility related protein (MRP 1), Tetraspanin 29 (Tspan 29), p24, MIC3, TSPAN29 Accession P21926 Amino Acid Sequence Protein sequence(P21926, Ser112 Ile195, with C 10*His) SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 11.

Product Specification


Species Human
Synonyms 5H9 antigen, Cell growth-inhibiting gene 2 protein, Leukocyte antigen MIC3, Motility-related protein (MRP-1), Tetraspanin-29 (Tspan-29), p24, MIC3, TSPAN29
Accession P21926
Amino Acid Sequence Protein sequence(P21926, Ser112-Ile195, with C-10*His) SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight Theoretical:11.3kDa Actual:10kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD9 is a cell surface glycoprotein that consists of four transmembrane regions and has two extracellular loops that contain disulfide bonds which are conserved throughout the tetraspanin family. Also containing distinct palmitoylation sites that allows CD9 to interact with lipids and other proteins. CD9 is commonly used as a marker for exosomes as it is contained on their surface. CD9 has a diverse role in cellular processes as it has also been shown to trigger platelet activation and aggregation. CD9 can also modulate cell adhesion[24] and migration.[25][26] This function makes CD9 of interest when studying cancer and cancer metastasis. However, it seems CD9 has a varying role in different types of cancers. Studies showed that CD9 expression levels have an inverse correlation to metastatic potential or patient survival.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 200439936

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
AGJ
Phoenix, US
★★★★★ 5
Great for training and play!
Size: Medium, Number of Items: 1
My German shepherd love this toy! Great to take on walks with you as light weight and can fit in your pocket. Stands up to the toughest of play. Great as reward toy for training in place of treats! We always have one on hand at home or out and about!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
R
Verified Purchase
Room112
Fort Morgan, US
★★★★★ 5
Great for big dogs
Size: Medium, Number of Items: 1
Our pup is now 15 months old (nearly 110 lb and still growing). We got this ball when he was 3 or 4 months old. GOODS - - Our pup fetches with extreme drive, and the rope helps him quickly snatch the ball off the ground (versus a tennis ball, in which we are worried he will go head over heels at times) - Our pup also loves to play fetch in the water, and this ball floats great and again, the rope gives another point to bite onto - The yellow color is easy to see, even in grass - Our pup typically fetches the ball, and leaves the rope mostly out of his mouth. So, throwing the ball doesn't result in saliva-covered hands - It's pretty easy to throw the ball 50', and possible to throw it 100' - It doesn't roll/bounce, so if you are for example playing fetch on your front lawn and are concerned with a tennis ball rolling into the street, this one alleviates that issue - Our pup is spoiled and has several balls. This is absolutely his go to ball. We have woken up in the morning before to see him standing next to the bed with the ball in his mouth, asking us to get up and play. BADS - - Occasionally when he goes to fetch it, he will step on the rope as he tries to pull up on the ball. - We have gotten this ball stuck in trees multiple times. In fact, there is one stuck on the roof of our church from playing fetch on the lawn there. :-/ Not a fault of the ball, but if you start whipping it around like nunchucks, it might not go where you want. - The near max you can through this ball is 100'. And since it doesn't roll/bounce, throw distance is throttled. We often play fetch in a local baseball field, and have no issue wearing him out with this ball. However, if you are planning on throwing a ball the distance of half a football field, you might want to consider something else. SIZE - - We purchased both the medium and the large. Even though our pup is huge and can fit a soccer ball in his mouth, he still prefers the medium. It's easier for him to get in his mouth and breath while running back. The medium is the size of an orange, whereas the large is the size of a grapefruit. DURABILITY - - We have gone through about 4 of these balls, BUT this is because we lost 3 of them. We believe he dropped one out of the car window while we were driving, one is on the roof of our church, and I forget about the other one. On the first one we had, the stitching behind the black tape was down to a few threads after about 5 months. Given duration we use these balls (every day) and the joy he gets from them, I feel the durability is good for the price. - We do play tug with the ball at times, and no issues there Enjoy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 17, 2013
G
Verified Purchase
Greg
Natrona Heights, US
★★★★★ 3
Good but better options out there.
Good ball, but is a cheaper version of the Foamster sold online. The rope is cheap and comes apart, and can be abrasive to a dogs mouth. The Foamster uses a higher quality ball and are more durable and use grippy biothane straps rather than cheap rope. They are also made to order in the USA with lots of fun colors. Worth the extra money if your dog likes these balls.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 10, 2025
K
Verified Purchase
Kristen
Port Orchard, US
★★★★★ 5
Fun toy for fetch
Size: Medium, Number of Items: 1
Daisy loves this toy. I found it from her dog trainer, and it makes rewarding her with a quick tug of war and fetch really easy. Also it’s shockingly durable. It looks like foam, but she has not destroyed this one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 11, 2025
S
Verified Purchase
seafan
Boise, US
★★★★★ 5
Sturdy and soft like hiking on clouds
Size: Large, Color: Color Mix
I am in love with these socks! In fact I've reordered five more times and have told my hiking friends about them, and they've ordered them now, too. We all love them. This is an excellent price for a 70% Merino wool sock. They wick away moisture & keep your feet nice and dry and comfortable in your boots. They're very cushiony yet your feet do not overheat. I bought these for the gym and for hiking. I actually hike about a hundred miles a month so I can tell you these socks go through a lot with me! The ankle cut socks are perfect for both my trail runners and my actual low ankle boots. The arch support keeps the sock firm on my foot and does not allow the sock to bunch up down towards the toe. The Merino wool helps to control moisture and my feet do not stink after a 6-7 mile hike. And oh my gosh they are so soft! It's like walking on clouds. I've had no issues with holes in the socks and will definitely update later if I do. I highly recommend these socks and tell your friends about them too
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 16, 2026

recommand products