SKU: 22079959520

Human Jagged1, His tag

Sale price$117.00 Regular price$130.00
Save 10%

Pay in installments of $32.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 9 - Sep 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Jagged1, His tagProduct Specification Species Human Synonyms hJ1, CD339, JAG1, JAGL1 Accession P78504 Amino Acid Sequence Protein sequence (P78504, Ser32 Ile335, with C 10*His)

Product Specification


Species Human
Synonyms hJ1, CD339, JAG1, JAGL1
Accession P78504
Amino Acid Sequence

Protein sequence (P78504, Ser32-Ile335, with C-10*His) SGQFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 35.4 kDa Observed MW: 44 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Jagged1 (JAG1) is one of five cell surface proteins (ligands) that interact with four receptors in the mammalian Notch signaling pathway. The Notch Signaling Pathway is a highly conserved pathway that functions to establish and regulate cell fate decisions in many organ systems. Once the JAG1-NOTCH (receptor-ligand) interactions take place, a cascade of proteolytic cleavages is triggered resulting in activation of the transcription for downstream target genes. JAG1 gene is expressed in multiple organ systems in the body and causes the autosomal dominant disorder Alagille syndrome (ALGS) resulting from loss of function mutations within the gene. ALGS is an autosomal dominant multi-system disorder affecting several body systems including the liver, heart, skeleton, eye, facial structure, kidneys and vascular system. JAG1 expression changes have been implicated in many types of cancer. Up regulation of JAG1 has been correlated with both poor overall breast cancer survival rates and an enhancement of tumor proliferation in adrenocortical carcinoma patients.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 22079959520

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
MISS JENNIFER TAYLOR
Draper, US
★★★★★ 5
Nice toy
Style: Variety Pack - Large (3-pack)
Good idea, no stuffing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
J
Verified Purchase
J. Rothenberger
Los Angeles, US
★★★★★ 3
The Ad got me, the reality didn't
Style: Variety Pack - Large (3-pack)
Directly from the ad- "Exclusive Noisemakers - Each large toy includes 3 high-quality round squeakers to deliver more sound to keep your best friend entertained.". Now my neighbor bought this squirrel with three high-quality squeakers nearly a year ago. It's ragged and tattered I just recently sewed it up for him where he chewed the one leg odd, but those three noise makers are still squeaking. Whe I got my pup, I immediately went to buy one and they were no longer selling them, so I've been on a search for one or an equivalent. These are not. There's no stuffing to get all over the place when your pup breaks into it, a plus. However the squeakers weren't particularly loud and were silenced in a few hours. Two were dead and the remaining one was very well on its way. The toy itself was pretty much intact but that had more to do with the lack of attention from the dog than how rugged the toy is. He'll pick it up once in a while but it certainly didn't meet my expectations. The good thing is that there are three of them so I can give him some brief excitement in the future. Wouldn't buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 24, 2023
E
Verified Purchase
Eileen
Massapequa, US
★★★★★ 5
Strong Chewer Friendly Toy
Style: Variety Pack - Large (3-pack)
My dog is a rough chewer and these last a really long time (clearly since this beaver's face is long gone! The no stuffing is a win too for cleaning up afterwards.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
C
Verified Purchase
Craig Curran
Birmingham, US
★★★★★ 5
Longest living toy ever!
Style: Variety Pack - Large (3-pack), Style: Variety Pack - Large (3-pack)
This review is 2 years in the making! Purchased over 2 years ago, all three are still in active play, still squeek, with no holes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
N
Verified Purchase
NSB
Boise, US
★★★★★ 5
My dog's favorite toy* (*see durability warnings*)
Style: Variety Pack - Large (3-pack)
This is a plush toy, so *if your dog is a destroyer of things, it'll destroy this toy easily/instantly* & if they're not destroyed right away, I'd definitely expect them to be destroyed eventually just given the type of toy it is- plus much of that depends on the way your dog plays. That said, this plush, multiple squeaker toy has held up really well for the amount of use it gets in our home. Because it contains 3 separate squeakers in it, these toys have been like heaven for my 3 year old, male, Toy Fox Terrier to play with- he freaks out when we squeeze more than 1 squeaker at the same time & I don't do all 3 at once bc I think his head might actually explode LoL 😋! Seriously, ever since he's grown out of puppy-hood, he's much less destructive with his toys now, so we are able to buy toys like these for him, have him go nuts freaking out on them & have them hold up pretty well/for a while before it's time for a replacement, yet since they're not very expensive, it's not terribly hard to replace them if needed (he's still using the last toy in the original 3 pack we got for him). It's great for fetching via a "flinging" motion (they're not heavy enough to actually throw) if you have a smaller dog who doesn't cover much distance too readily, but the best part of this toy is the elongated design of it, because it makes for a perfect "tug of war" type of playtime toy with my little buddy (tugging is a behavior which you may or may not want to encourage your dog to do depending on its disposition). Since my dog thankfully isn't really destructive & doesn't have issues releasing a toy from a tugging interaction anymore, these items have held up pretty well for a plush type toy, but again, if you own a dog known for destroying their toys, or anything else for that matter, these probably aren't going to work out well for you. Given they're pretty cheap to replace, for a throw ready, tug toy which has 3 different places for a dog to chomp on to make it squeak, they've turned out to be perfect for our smaller sized pup & have become a favorite toy of my little guy which he's always ready to play with, at any time, with anyone- he's got it ready to go a lot of the time when we get back home to him after being out. Again, you'll need to go with Kong or something similarly durable if your dog destroys things or is still a puppy who doesn't know better, but for an average amount of wear & tear they've held up really well while remaining at the top of my dog's favorite toy list. So recommended for sure, but just know if you've got a chewy character on your hands, despite all the fun they'd have with these, I'd get a more durable toy instead of this one as these plush toys, while good quality, will not hold up to prolonged abuse (as is the case with most plush toys sold). However, for an "average destruction" level dog, it seems well enough made to last a decent amount of time & they're a source of an enjoyable playtime for our dog & therefore for us as his owners as well! Definitely recommend for it's features, like 3 different squeakers, it's great design for a tugging style of play & it's overall good durability for a plush style toy. 👍
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 2, 2019

recommand products