Pay in installments of $67.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 17 - Aug 22
For Your Every Summer RSVP, with Code: SUMMER15
Description
CEACAM-1/CD66a His Tag Protein, CynomolgusProduct Specification Species Cynomolgus Synonyms CEACAM1, CD66a, BGP, BGP1, BGPI Accession XP_005589426. 2 Amino Acid Sequence Gln35 Gly428, with C terminal 8*His
Product Specification
| Species | Cynomolgus |
| Synonyms | CEACAM1, CD66a, BGP, BGP1, BGPI |
| Accession | XP_005589426.2 |
| Amino Acid Sequence | Gln35-Gly428, with C-terminal 8*His QLTIESRPFNVAEGKEVLLLAHNLSQNLIGYNWHKGERVDAKRLIVAYVIETKQTTPGPAHSGREMIYSNASLLIQNVTQNDTGSYTLQVIKGDLVNEEATGQFRVYPELPKPNITINNSNPVEDKDVVTFTCESEAQDTTYLWWVNNQSLPVSSRLQLSNGNKTLTLLSVLRNDTGPYECEIQNPVSANRSDPVTLNVTYGPDTPTISPSDTYYRPGANLSLSCSAASNPPAQYSWLINETFQQSTQELFIPNITVNNSGSYTCHANNSVTGRNRTTVKMIIVSEQSLVVAQPQIKASKTTVTEDKDYVNLTCSTNDTGISISWFFKDQSLPSSERMKLSQDNATLSINPVKREDAGNYSCEVFNLISKNRSDPIVLIVNYNNPAQENSLPAGGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 65-93kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1、Tsugawa N. et al. (2021) CEACAM1 specifically suppresses B cell receptor signaling-mediated activation. Biochem Biophys Res Commun. 535: 99-105. |
Background
Carcinoembryonic antigen-related cell adhesion molecule 1 (CEACAM1) is a type I transmembrane glycoprotein and a member of the CEA family. The extracellular domain of CEACAM1 consists of a membrane-distal immunoglobulin (Ig)V-like N-region and variable numbers of alternating IgC1- and IgC2-like proximal regions. Therefore, this molecule is also classified as a member of the Ig supergene family. Several heterophilic ligands for the N-domain of CEACAM1 have been reported. However, homophilic ligation of the N-domains of CEACAM1 with another N-domain of CEACAM1 is the predominant means of physiologic interaction. CEACAM1 has been reported to be involved in several functions such as tumor growth, angiogenesis, endocrine function and immunology in humans and rodents.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.9 ★★★★★
Based on 8 reviews
Sort
Product Reviews
★★★★★ 5
What I've been looking for
Size: Large (Pack of 1)
Just got my Nero Ball. Only used it once, but really like it. I've tried other "ball on a string" type toys, with unsatisfactory results. I'll be using it as a training reward, and my boy, who is a pretty ferocious tugger, is going to learn 2 new things with this ball. 1st, to target the ball instead of the rope, and 2nd, that it's for a little gentle tugging instead of the full throttle stuff he does otherwise. After our 1st session with the Nero Ball, he's picking up on the new rules quickly. We'll see how it does long term, but I think this is one I'll stay with.
*UPDATE* Been using my Nero Ball for a month now. I'm tempted to call it the 'Hero Ball' because it's just that terrific!! For me, the key has been putting in the time to allow both myself & my dog to develop the skill to use this tool smoothly. May sound strange, but using a toy as a training reward requires practice, and each different toy configuration requires different handling. It's time well spent - we're both having a lot of fun!
Kudos to the designer of this ball. Every detail has been carefully considered, from the length & material of the rope (just the right length that the dog won't step on it; material is easy on the hand while still being tough enough to withstand a few toothy grabs; the loop is the perfect size to grab for a little tug or to pass the ball through to slip-knot it onto a belt loop). The ball is also just right. The knobs make it non-slip, the rubber eliminates tennis ball fuzz concerns, and being semi-hard and hollow makes it slightly compress-able, which makes it a higher value reward than a solid ball that can't be compressed.
While this ball will not work for every application or for every dog, if you carefully read & understand the information provided and don't expect it to work outside those parameters, you will be pleasantly surprised by a very well designed, well constructed tool that you can use to enhance your training or play sessions with your dog.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2016
★★★★★ 5
Great Quality!
Size: Large (Pack of 1)
Great quality!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
★★★★★ 4
Nice toy
Size: Large (Pack of 1)
This product is generally durable and easy to throw. However, the original rope knot came undone after just four throws, per my wife. Unfortunately, my knot-tying skills are limited to fishing knots and slip knots, which is on me. While I can't give a perfect score, I believe it deserves a 4.5 out of 5 stars due to the knot issue. A simple solution would be to apply heat shrink tubing over the knot and heat it to secure it, which would enhance its reliability and potentially elevate the rating to a perfect five stars.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2025
★★★★★ 5
Our German Shepherd loves it!
Size: Large (Pack of 1)
Order arrived promptly and in good condition. Our GSD barely let us get it out of the package before wanting to play with it. Works great as training reward and for fetch games. Been using it for three weeks, and it is holding up well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
★★★★★ 5
I think this family company improved the strength of the rope staying in the ball
Size: Large (Pack of 1)
I bought two of these balls when I needed to replace my old ones. After I got them I decided to read some reviews and I noticed people were complaining about their rope pulling through easily and their dog chewing through the rope fast. First of all this strictly is a ball for reward and yes tug as a reward while training mostly working dogs and sport dogs so the rope is designed perfectly for that reason. It’s not a chew toy. And as for the rope pulling through easily. I have a big male shepherd over 100 lbs who I was participating in a dog sport with a lot of Really strong tugging and this ball stood up to it perfectly. I think they must have taken advice from the reviews and improved the b-ball if people were having the issue of the rope coming out and someone had suggested putting a piece of something inside the ball to hold the rope in better and now there is one so I would feel fine about suggesting this ball as a reward and training ball. My dog loves them!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 1, 2019