SKU: 24124441609

Apolipoprotein A-I/APOA1 His Tag Protein, Human

Sale price$144.00 Regular price$160.00
Save 10%

Pay in installments of $40.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 7 - Sep 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Apolipoprotein A-I/APOA1 His Tag Protein, HumanProduct Specification Species Human Synonyms Apolipoprotein A I, Apo AI, ApoA I, Apolipoprotein A1, APOA1; Apolipoprotein A I, Apo AI, ApoA I, Apolipoprotein A1, APOA1 Accession P02647 Amino Acid Sequence Asp25 Gln267, with N 6*His

Product Specification


Species Human
Synonyms Apolipoprotein A-I, Apo-AI, ApoA-I, Apolipoprotein A1, APOA1;Apolipoprotein A-I, Apo-AI, ApoA-I, Apolipoprotein A1, APOA1
Accession P02647
Amino Acid Sequence Asp25-Gln267, with N-6*His MHHHHHHDDDDKDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ.
Expression System E.coli
Molecular Weight 29.6 kDa
Purity

>98% by SDS-PAGE and RP-HPLC

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris-HCl, 100mM NaCl, pH8.0
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Apolipoprotein A-I/APOA1 mainly exists in high density lipoprotein (HDL) particles, which can prevent excessive accumulation of cholesterol in macrophages, form foam cells, deposit on the arterial wall, and cause atherosclerosis. The main function of APOA1 is to activate lecithin cholesterol acyltransferase (LCAT) in HDL complex, catalyze cholesterol esterification, and then dissolve more cholesterol-HDL complex, increase the cholesterol transport capacity of HDL particles and the ability of liver to metabolize cholesterol. Therefore, APOA1 is an important marker to evaluate the ability of blood cholesterol clearance.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 24124441609

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
MICHELLE Lewis
Omaha, US
★★★★★ 5
Best Ball ever! Aussie is obsessed
Size: 6 Inch Diameter, Color: Orange
I will never buy any other ball!!!! I bought the 8 inch which my crazy Aussie liked. The 6 inch one he won't stop carrying it around. his face use to be so sad when he would pop other balls. This one deflates and fills back up instantly! He chases it and chews on it. We gone through a lot of balls, but this is going to be a staple in our house!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2026
V
Verified Purchase
Video Paul
San Leandro, US
★★★★★ 5
Great for crazy pups!
Size: 8 Inch Diameter, Color: Ocean Blue
Tough and fun! This is a great toy to keep in the yard for play. I have a heavy chewer. He can get a hold of it and carry it around but it doesn't pop. It is soft enough but also strong. My dog loves to herd it around. He loves it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
M
Verified Purchase
Marie Phillips
Bozeman, US
★★★★★ 4
Durable, bouncy fetch toy that dogs usually love
Size: 8 Inch Diameter, Color: Ocean Blue
Bouncing Dog Toy is generally very well received, especially for dogs that enjoy fetch and active play. It is made from a flexible, puncture resistant material that can handle a lot of biting and chewing without immediately popping or losing shape. Many owners like that it has a good bounce and is easy for dogs to grip, even when wet or slobbery. It is also lightweight enough for kicking, tossing, or rolling, which makes it great for interactive play sessions. A big highlight is that it floats, so it works well for water play as well as backyard or park fetch. The 8 inch size is especially good for medium to large dogs because it is big enough to avoid accidental swallowing but still easy for them to carry and chase. Most complaints are pretty typical for any dog toy of this type, meaning very strong chewers can eventually damage it, and some dogs may puncture it over time, but even then it often keeps its shape and continues to be usable
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
C
Verified Purchase
colin g.
Massapequa, US
★★★★★ 5
Small, cheap & cute
Style: Charming Squeaky Dog Toys, Style: Charming Squeaky Dog Toys
BUY THEM, SO WORTH IT! Sturdy for the low price, if you've got a power chewer at home, these will not be challenging to destroy and they'll probably only last a couple hours. My dogs loved them, even my big dog. They haven't destroyed them yet, they chose instead to carry them around the whole house and yard. The toys are small, my 20lb dog can (and did) fit two in his mouth at once because he loved them so much and he even "buried" a few toys around the house in blankets, laundry hampers, couches...... for later. All in all, the pups were so happy which made me happy, all for under $20. Going to order another box with the different theme for later.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
S
Verified Purchase
Susan George
Bozeman, US
★★★★★ 5
Great toys for a puppy!
Style: Charming Squeaky Dog Toys
I was happily surprised by the quality and uniqueness of each of the dog toys in this purchase. My new puppy loves them! So cute and original, and each has a squeak to it. They are just the right size for a young puppy! Money well spent.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 14, 2026

recommand products