Pay in installments of $90.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 27 - Oct 2
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
COL6A3 His Tag Protein, HumanProduct Specification Species Human Synonyms COL6A3, collagen, type VI, alpha 3 Accession P12111 Amino Acid Sequence Thr3101 Thr3177, with N terminal 8*His HHHHHHHHTEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMGT Expression System HEK293 Molecular Weight 11 13kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4 Reconstitution
Product Specification
| Species | Human |
| Synonyms | COL6A3, collagen, type VI, alpha 3 |
| Accession | P12111 |
| Amino Acid Sequence | Thr3101-Thr3177, with N-terminal 8*His HHHHHHHHTEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMGT |
| Expression System | HEK293 |
| Molecular Weight | 11-13kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1、Kim, Gloria B et al. (2022) Quantitative immunopeptidomics reveals a tumor stroma-specific target for T cell therapy. Science translational medicine. 14: 660. |
Background
Mutations in the genes COL6A1, COL6A2, and COL6A3, coding for three α chains of collagen type VI, underlie a spectrum of myopathies. The COL6A3 gene provides instructions for making one component of type VI collagen, which is a flexible protein found in the space that surrounds cells. The COL6A3 protein is a component of type VI collagen and is present in connective tissues throughout the body, but exon 6 is only expressed in stromal cells in the tumor microenvironment. Collagen is found in the extracellular matrix, which is necessary for cell stability and growth. Research suggests that type VI collagen links basement membranes, which are thin, sheet-like structures that are part of the extracellular matrix, to nearby cells.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.4 ★★★★★
Based on 23 reviews
Sort
Product Reviews
★★★★★ 5
Must have for pets dental care!
These toothbrushes are perfect! My kitten had gingivitis and the vet said I could brush her teeth with a normal toothbrush but I’m so glad I got these instead! As you can see in the video the bristles go all the way around so I basically just put it in her mouth and she does most of the work for me! I also appreciate it’s small, she’s a tiny kitten so it’s perfect for her. These are a must if you need to brush your pets teeth. See the video for yourself! It’s a no brainer!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 12, 2026
★★★★★ 3
Good size brush-suction isn't great
The brush itself is a good size and I like that it is round so it's easy to brush. I wasn't as lucky as others to get my cat to start chewing on their own so it will be a process to get my cat used to it. For the brushes itself, it's a good deal for the price. The suction holder doesn't work well at all and only holds some of the time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 21, 2024
★★★★★ 5
Helps my cat brush his teeth
I’ve now purchased these twice for my sweet boy. He loves to brush his teeth with these! They aren’t as durable as I’d like, but also my boy is a super chomper. I wish they were just a bit cheaper!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026
★★★★★ 5
Works great on removing food particles from your cats teeth, especially when they bite down on it!
My kitten wanted no part of me, brushing his teeth. In fact, I tried to use a feline soft toothbrush, and I ended up making his little gum on his main fang bleed, I felt horrible about it! So when I discovered these and saw how soft they are, I bought these! My kitten started biting it right away and now loves his new ritual, biting on it and letting me gently rub along his gums, it actually grabs food particles when he bites down on it! He seems to loves the feeling of it, as I brushed his teeth, at at 3-5 times a week with it. He has become really good about letting me use it. He does loves when I also rub it along his jaw/gum area as it stimulates those nerve feel-good nerve endings. A winner with my boy Otis!🐾💕
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
★★★★★ 5
FABULOUS scent!!
Beautiful soap/lotion set that enhances my decor. But mostly I love this set because of the smell, it's devine! My daughter recently came back from a trip to Italy and Spain and said "Mom, this smells like the soaps we had in Sicily!"
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2026