SKU: 26129102840

Axl His Tag Protein, Mouse

Sale price$162.00 Regular price$180.00
Save 10%

Pay in installments of $45.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Axl His Tag Protein, MouseProduct Specification Species Mouse Synonyms Axl, UFO, Tyro7, JTK11, ARK Accession Q00993 Amino Acid Sequence His20 Pro443, with C terminal 10*His

Product Specification


Species Mouse
Synonyms Axl, UFO, Tyro7, JTK11, ARK
Accession Q00993
Amino Acid Sequence His20-Pro443, with C-terminal 10*His HKDTQTEAGSPFVGNPGNITGARGLTGTLRCELQVQGEPPEVVWLRDGQILELADNTQTQVPLGEDWQDEWKVVSQLRISALQLSDAGEYQCMVHLEGRTFVSQPGFVGLEGLPYFLEEPEDKAVPANTPFNLSCQAQGPPEPVTLLWLQDAVPLAPVTGHSSQHSLQTPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQRPHHLHVVSRQPTELEVAWTPGLSGIYPLTHCNLQAVLSDDGVGIWLGKSDPPEDPLTLQVSVPPHQLRLEKLLPHTPYHIRISCSSSQGPSPWTHWLPVETTEGVPLGPPENVSAMRNGSQVLVRWQEPRVPLQGTLLGYRLAYRGQDTPEVLMDIGLTREVTLELRGDRPVANLTVSVTAYTSAGDGPWSLPVPLEPWRPGQGQPLHHLVSEPPPRAFSWPGGGSGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight 60-78kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Weinger J G. et al. (2011) Loss of the receptor tyrosine kinase Axl leads to enhanced inflammation in the CNS and delayed removal of myelin debris during Experimental Autoimmune Encephalomyelitis. J Neuroinflammation. 8: 49.

2、Linger R M. et al. (2010) Taking aim at Mer and Axl receptor tyrosine kinases as novel therapeutic targets in solid tumors. Expert Opin Ther Targets. 14(10): 1073-1090.

3、Cavet M E. et al. (2010) Gas6-Axl pathway: the role of redox-dependent association of Axl with nonmuscle myosin IIB. Hypertension. 56(1): 105-111.

4、Rankin E B. et al. (2010) AXL is an essential factor and therapeutic target for metastatic ovarian cancer. Cancer Res. 70(19): 7570-7579.

Background

AXL Receptor Tyrosine Kinase is also known as Tyrosine-protein kinase receptor UFO, which belongs to the protein kinase superfamily, Tyr protein kinase family and AXL/UFO subfamily. Mature human Axl consists of a 426 aa extracellular domain (ECD) that contains two Ig-like domains and two fibronectin type III domains, a 21 aa transmembrane segment, and a 422 aa cytoplasmic domain that includes the tyrosine kinase domain. In the nervous system, Axl and its ligand Growth-arrest-specific protein 6 (Gas6) are expressed on multiple cell types. Axl functions in dampening the immune response, regulating cytokine secretion, clearing apoptotic cells and debris, and maintaining cell survival. Axl is upregulated in various disease states, such as in the cuprizone toxicity-induced model of demyelination and in multiple sclerosis (MS) lesions, suggesting that it plays a role in disease pathogenesis. The receptor tyrosine kinase (RTK) AXL has been associated with poor prognosis in numerous malignancies and the emergence of therapy resistance. Upon binding to its ligand GAS6, AXL regulates cell signaling cascades and cellular communication between various components of the tumor microenvironment, including cancer cells, endothelial cells, and immune cells. Converging evidence points to AXL as an attractive molecular target to overcome therapy resistance and immunosuppression, supported by the potential of AXL inhibitors to improve ICI efficacy. Axl contributes to cell survival, migration, invasion, metastasis and chemosensitivity justify further investigation of Axl as novel therapeutic targets in cancer. The soluble AXL receptor as a therapeutic candidate agent for treatment of metastatic ovarian cancer.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 26129102840

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Dean
West Palm Beach, US
★★★★★ 5
Just right, great quality and value (in the price)
Size: 11.5 X-Wide, Color: Burgundy
Exactly what I'd expect from a Florsheim. I'm delighted. Folks, let me share one mistake I made on my way to a good fitting pair of shoes. I ordered some in my size (I have a big foot, especially in width). I ordered what I thought I needed and it came in wide enough, but too short (the short was the surprise), but we all are told: "Manufacturers vary in their sizes not only from each other but from shoe model to shoe model." I want you to know I believe in that when it applies to clothes, especially children's and womens fashions in my life's experiences, but NOT with shoes, especially main-brand-deluxe. I ordered the next half-size up and now I have too large, how can that be? I found out when I pulled the paper stuffing out, in particular the LAST glob that extends from the middle to the toe, that it WASN'T the last glob, there was indeed a rather small glob still way down in the toe, almost pointless for this minor bit of stuffing being separate from the other, but it was. I had already innocently troubled Amazon with returns of shoes that would have fit, so I'll keep the half-size too large as a life lesson. I ordered this pair in the size I believed I was all along and viola, a good fit. What changed? When that last toe piece of paper wadding that's hard to see and even harder with a big hand to reach, the shoe fit perfectly. That's a lot of trouble because of a small piece of paper that was hard to see, but that's why I write this review for you so that you can make sure all the paper is really out when you already think it is. Amazon has been good enough not to hold me accountable and in return I'll not only repeat buy, I tell you of my experience.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 3, 2014
D
Verified Purchase
Doc
Fort Morgan, US
★★★★★ 5
Great price great shoe
Size: 12, Color: Burgundy Polished Full Grain
Excellent shoe. Tried the Sebago penny loafer and the sizing was ridiculous. These J and M are sized perfectly. I’ve had them before and they wear like iron. Very comfortable right out of the box.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
R
Verified Purchase
roger mendes
Chelsea, US
★★★★★ 5
One of the best shoes
Size: 9.5, Color: Black Polished Full Grain
Outstanding. Fashionable, most comfortable and good construction. No sines of use after quite some time. Highly recommended.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 21, 2026
F
Verified Purchase
Fabric Crazy
New York, US
★★★★★ 5
Really nice shoes
Size: 9, Color: Black Polished Full Grain
My husband enjoys wearing these shoes. Very classy looking. They fit well. They arrived quickly. He liked them so much he ordered another pair in a different color which have worked out just as well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 3, 2026
T
Verified Purchase
the agitator
Battle Creek, US
★★★★★ 4
Penny Loafer
Size: 11 Wide, Color: Burgundy Polished Full Grain
I am ending them bak and will order the sae shoe at size 10 1/2. Most shos I fit are 11 however these were too large. They are a beautiful shoe! I will ofder a 10 1/2
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 13, 2025

recommand products