SKU: 27536910523

Human CD235a , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 13 - Sep 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD235a , His tagProduct Specification Species Human Synonyms Glycophorin A, MN sialoglycoprotein, PAS 2, Sialoglycoprotein alpha, GYPA, GPA Accession P02724 Amino Acid Sequence Protein sequence(P02724, Ser20 Glu91, with C 10*His) SSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 9. 6kDa Actual: 15 20, 40 70kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical

Product Specification


Species Human
Synonyms Glycophorin-A, MN sialoglycoprotein, PAS-2, Sialoglycoprotein alpha, GYPA, GPA
Accession P02724
Amino Acid Sequence

Protein sequence(P02724, Ser20-Glu91, with C-10*His)

SSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:9.6kDa Actual:15-20, 40-70kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Glycophorin A (MNS blood group), also known as GYPA, is a protein which in humans is encoded by the GYPA gene. GYPA has also recently been designated CD235a (cluster of differentiation 235a). Glycophorins A (GYPA; this protein) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. In addition to the M or N and S or s antigens, that commonly occur in all populations, about 40 related variant phenotypes have been identified. These variants include all the variants of the Miltenberger complex and several isoforms of Sta; also, Dantu, Sat, He, Mg, and deletion variants Ena, S-s-U- and Mk. Most of the variants are the result of gene recombinations between GYPA and GYPB.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 27536910523

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Deepika
Waukegan, US
★★★★★ 4
Classic old-fashioned presentation, versatile uses
Color: Diamond White, Color: Diamond White
I loved the presentation of this glitter in an old-fashioned atomizer perfume bottle with a pink squeeze puff. Because glitter powder is not prone to evaporation, an atomizer is actually a great way to package powder. I tried this product with the atomizer and without. Honestly, I was just looking for some sparkles on my cheekbones and a glitter streak in my hair for a New Years Party. The instructions advised that for a targeted glitter application, spray the glitter on your hand and apply it with a brush. I found that this way left too much glitter behind on my hand. Instead, I shook some glitter onto a piece of paper and mixed some with Aquaphor for application on my face. This helped the glitter adhere to my skin and lasted for hours. I mixed some glitter into hair gel and applied it to a streak in my hair. The larger pieces of silver glitter really sparkled this way. Overall, this packaging looks great and would be functional if you were looking for an all-over application. Otherwise, just using a simple bottle works as well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 31, 2025
D
DKMI
Dallas, US
★★★★★ 5
Woah, Shimmer!
Color: Late Autumn, Color: Late Autumn
I love cute little things like this with the spray bulb. They’re fun gifts. My daughter likes to shimmer sometimes. She kind of overdid it the first time. It does t take much to get a sparkly, fine shimmer. The photos are a bit exaggerated on the product page. You don’t have to “paint” your skin with it. It’s an easy application, and when used right really provides a nice accent. It’s light and has a quality look and feel.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 10, 2026
K
Kindle Customer
Belleville, US
★★★★★ 5
So pretty!
Color: Late Autumn
This shimmer is beautiful! It applies smoothly and evenly and it sparkles absolutely beautifully. You can do one spritz for a very light coverage or a few to really glow! I love the applicator - makes me feel fancy. It was a little bit sticky at first but it dries quickly and isn't sticky after that. It's a really great product to brighten up your look. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 12, 2026
A
Aria
Port Orchard, US
★★★★★ 5
This is such a fun little product.
Color: Diamond White
This is such a fun little product. The shimmer is really pretty and fine, not chunky or glittery in a bad way. It gives a nice glow without looking overdone. Super easy to apply and a little goes a long way. I’ve used it on my face and collarbones and it looks great in different lighting. For the price, I’m honestly impressed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 9, 2026
I
Inspector Gadget
Natrona Heights, US
★★★★★ 5
Glitter Puffs
Color: Late Autumn, Color: Late Autumn
*Poof* and then there was glitter. Boko Highlighter Powder Spray, Body Shimmer Spray for Glitter Highlighter Makeup makes it as easy as squeezing a bulb. The biggest part of the assembly of the product is to male sure you remove the plastic cap and the rubber tipped end. If you miss either the spray will seem to not work. Once properly set up the powder spray bottle only takes a modest squeeze to dust the skin with instant glitter and glory. I love the look, the easy to use spray, and the bottle itself which has a simple but elegant feel to it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 29, 2025

recommand products