SKU: 27552435815

R-Spondin 1(21-146) Protein, Human

Sale price$140.40 Regular price$156.00
Save 10%

Pay in installments of $39.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 3 - Sep 8

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

R-Spondin 1(21-146) Protein, HumanProduct Specification Species Human Antigen R Spondin 1 Synonyms RSPO1,CRISTIN3,FLJ40906,RP11 566C13. 1,R spondin 1 Accession Q2MKA7 1 Amino Acid Sequence Ser21 Ala146, with C terminal 8*His SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAGGGSHHHHHHHH Expression System HEK293 Molecular Weight 17 25kDa (Reducing) Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation

Product Specification


Species Human
Antigen R-Spondin 1
Synonyms RSPO1,CRISTIN3,FLJ40906,RP11-566C13.1,R-spondin-1
Accession Q2MKA7-1
Amino Acid Sequence

Ser21-Ala146, with C-terminal 8*His SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

17-25kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

The R-Spondin proteins comprise a family of secreted proteins, known for their important roles in cell proliferation, differentiation and death, by inducing the Wnt pathway. Several studies have demonstrated the importance of RSPOs in regulation of a number of tissue-specific processes, namely: bone formation, skeletal muscle tissue development, proliferation of pancreatic β-cells and intestinal stem cells and even cancer. RSPO1 stands out among RSPOs molecules with respect to its potential therapeutic use, especially in the Regenerative Medicine field,due to its mitogenic activity in stem cells. Here, we generated a recombinant human RSPO1 (rhRSPO1) using the HEK293 cell line, obtaining a purified, characterized and biologically active protein product to be used in Cell Therapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 27552435815

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Khrystal
Phoenix, US
★★★★★ 5
JAXPETY Room Divider Panel 6Ft Privacy Screen Wall Divider 88" W x 73" H - 3 Panel Black
Color: Black, Size: 3-Panel, Color: Black, Size: 3-Panel
I was looking for a screen to use while making video calls. I am on a budget, wanted something easy to put together, and would hide my apt in the background. Being on a budget, I thought my purchase qualified for the coupon. I was mistaken but contacted the seller. I received a quick response explaining how the coupon was applied. I was happy with the quick response and explanation which I verified when I went back to the page. The once all put together the screens are light weight and fairly easy to move. they do not seem to be made for easy daily breakdown. However, if you should need to take them apart to move or something, easy to break down. Depending on lighting will depend on if you find them transparent. I don't mind possible vague outlines; I was looking so no real details of my belongings in the background could be seen (shelves; figurines; etc.) My apt living room has no overhead light source, so floor lamps give light. In the 3 photos of 2 of the screens put together; the first is with a lamp in front and back of the screen as well as a tv on. The next has the tv off lamps still on and the screen reflecting the pc monitors. The third is with both lamps and the tv off, monitors on but not as reflective. In the box, you have all the parts you need as well as a small tool and an instruction manual. Item 'bags' are number [though they may come off in the box] to assist with assembly. Now assembly can be easy or hard depending on your abilities and the area you are working in. I have bad knees, so kneeling was not an option for me. My first attempt to put this together, I put the 'feet bases' on while still connecting the top bar. It made it twice as hard, and I stretched the fabric more than was necessary causing wholes around some of the stitching and stretching them a little. As well as causing some stitching to come undone on one of the pictured areas. Once I took off the 'feet bases', I had an easier time to screwing in the top bars. You will still need some hand strength, which I don't have much of, but it is possible. I use the grip things to open pickles jars. Once the screens were assembled, I followed the instructions of tying an outer screen to the inner screen and using the Velcro 'privacy flaps' to complete the connection. I have what I think is low shag carpeting which they were able to stand stably on once I wiggled them into standing straight up and in place. Given these post pandemic times, I am overall happy with both the divider and the price. The 2 things I do not like about the divider is the difficulty putting in the top bar [after connecting the top and sides] and storability when not in use issue I am having. Others with larger space will likely not have the last issue.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2025
W
Verified Purchase
WomanBehindTheMic
Draper, US
★★★★★ 5
100% worth it - I recommend to EVERYONE
I've seen coworkers and instructors using folding screens behind them for video calls since the pandemic started, and I finally gave in and purchased this one. I freaking LOVE it. I love that I can be on a video call and not have to worry about the angle of my laptop or having people 'in' my home while I'm at work. It's so nice. I may eventually buy and deconstruct a wall hanging to create some colorful fabric panels instead of the brown, but (and I say this as NOT a brown fabric-lover) the brown looks pretty nice. It's a very dark brown, and it serves as completely neutral while still feeling a bit warm. - No need for tools to assemble, even though it says screwdriver. - One thing: I thought it would fold up flat, and it does NOT fold up flat. Important to know. I just keep it folded up into a 16.5" (grabbed a tape measure to check) square column by my desk and unfold whenever I have video conferences. If you can't tell, I really like having this thing around. 100% recommend and would buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2021
R
Verified Purchase
riknik
Port Orchard, US
★★★★★ 4
it's a utility screen
Color: Black, Size: 3-Panel
It's a basic, utilitarian screen. It's what I expected it to be. Assembly isn't hard, but it does require two people when stretching the fabric between the poles. I got it to use in a closet to separate the water heater from the washer/dryer, so it'll be perfect for that. Pros: it's opaque and tall (my 6'4" husband can't see over it unless he is standing against it) and I like the ability for the three pieces to stand separately of each other. Cons: it's flimsy. It wobbles and will tip over easily.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 9, 2022
J
Verified Purchase
Jane Gios
Lowell, US
★★★★★ 5
Great for the price
The item is great bit I wish it were a bit more sturdy and it folded flat. It folds into a square so it does take up some room when it's not in use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2021
K
Verified Purchase
K. Torrance
Dallas, US
★★★★★ 1
Cheap, screw holes don't line up, screen is to short, and bars take WD-40 and a mallet
This has been my worst purchase on Amazon ever. DO NOT BUY. My first issue was that bars #4 and #5 would not go together, I ended up buying WD-40 and a mallet and that kind of got them together. Now I went to but the screen on (which is almost see thought) and the screen is to short. I can't attached the bottom bar to the tall bar. The screw hole is in the wrong spot, so the screen is not secure. No amount of pulling on the screen will make it grown .25" longer. Since I can't get the bars secure the walls are not steady and fall over easily. The feet did go together very nice. I can't return them according to Amazons policy. I bought 2 sets. I'm not going to try to build the other set I have. And I can't take apart the first set, since the bars are so tightly together. Also the polls have rust on them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 10, 2023

recommand products