SKU: 27699355593

Mouse CLEC7A, His tag

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CLEC7A, His tagProduct Specification Species Mouse Synonyms Beta glucan receptor, C type lectin superfamily member 12, Dendritic cell associated C type lectin 1(DC associated C type lectin 1; Dectin 1), Bgr, Clecsf12, Dectin1 Accession Q6QLQ4 Amino Acid Sequence Protein sequence (Q6QLQ4, Gly71 Leu244, with C 10*His)

Product Specification


Species Mouse
Synonyms Beta-glucan receptor, C-type lectin superfamily member 12, Dendritic cell-associated C-type lectin 1(DC-associated C-type lectin 1; Dectin-1), Bgr, Clecsf12, Dectin1
Accession Q6QLQ4
Amino Acid Sequence

Protein sequence (Q6QLQ4, Gly71-Leu244, with C-10*His) GHNSGRNPEEKDNFLSRNKENHKPTESSLDEKVAPSKASQTTGGFSQPCLPNWIMHGKSCYLFSFSGNSWYGSKRHCSQLGAHLLKIDNSKEFEFIESQTSSHRINAFWIGLSRNQSEGPWFWEDGSAFFPNSFQVRNTAPQESLLHNCVWIHGSEVYNQICNTSSYSICEKELGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 21.5 kDa Observed MW: 30 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CLEC7A is a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. It functions as a pattern-recognition receptor for a variety of β-1,3-linked and β-1,6-linked glucans from fungi and plants, and in this way plays a role in innate immune response. Expression is found on myeloid dendritic cells, monocytes, macrophages and B cells. The C-type lectin receptors are class of signalling pattern recognition receptors which are involved in antifungal immunity, but also play important roles in immune responses to other pathogens such as bacteria, viruses and nematodes. Also operating as a co-stimulatory molecule via recognition of an endogenous ligand on T-cells, which leads to cellular activation and proliferation, CLEC7A can bind both CD4+ and CD8+ T cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 27699355593

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
johnny boy
Fort Morgan, US
★★★★★ 5
Very happy with my purchase
Color: Black8017, Material Type: Leather
Very high-quality. Holds all my cards in cash.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
R
Verified Purchase
Reviewology
Bozeman, US
★★★★★ 5
Amazing Wallet!
This is a great wallet. I searched through many styles with similar features, but most did not have the pull down side lever to lift the cards. That feature is exactly why I chose this one. The leather feels high quality and not cheap at all. It is very durable. The money clip is extremely tight and holds cash securely with no risk of anything slipping out. I also wanted a wallet that still opens to display a driver’s license and daily use cards while remaining slim, and this one checks every box. It is compact but holds a surprising amount. My husband absolutely loves it and he is very picky about wallets. There are multiple slots not only for cards but also for holding papers or notes. There is even an additional slot behind the money clip for extra storage. The pull down button smoothly lifts all the cards at once and fans them out so each card is visible and easy to grab. I was unsure how this mechanism would work at first, but the cards are slightly staggered just enough to clearly see each one. You simply grab the card you want and push the stack back down into the wallet. We chose the carbon black version and it is sleek, lightweight, and looks very sharp. My husband mentioned it needs a little breaking in due to the quality construction, but it is still easy to access everything he needs and stays compact, which was most important to him. It also comes in a very nice black gift box with fitted foam that securely holds the wallet, making it perfect for gifting or safe storage before use. I highly recommend this wallet. For the price, it cannot be beaten. I searched extensively for the best option at a fair price point, and this one easily compares to wallets that cost close to or even over $100.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 10, 2026
R
Verified Purchase
Rev Jae
Los Angeles, US
★★★★★ 5
Typecase Wallet for Men
Color: Carbon Fiber Black, Style: Standard Wallet
This wallet has plenty of room for cards and id's. Not bulky nor is it difficult to remove and use cards. Love the appearance and RFID protection. Also love the money clip.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
J
Verified Purchase
Jeremy Merritt
Dallas, US
★★★★★ 5
Great quality wallet
Color: Carbon Fiber Black, Style: Standard Wallet
Holds 6 cards in pop up slot. Others can fit inside the wallet. ID is semi easy to remove. Great quality and durability. Cash doesn’t come loose even in your pocket all day. Will not mag to your phone just fyi.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
A
Verified Purchase
AustyPuff
Los Angeles, US
★★★★★ 4
Almost Perfect - Compact, Strong Magnet, Minor Card Access Issue
Color: Alaska Black, Style: Standard Wallet, Color: Alaska Black, Style: Standard Wallet
This is hands down the best wallet I’ve ever had. I love how compact it is while still holding quite a bit. On the front, it holds two cards, although I find the thumb slot a little short — it doesn’t extend the second card enough, so you have to dig a bit to get it out. The inside card holder (the non-window one) is also a bit tight. The magnet that holds the bifold together is very strong. The first section of the wallet (the bifold) holds three cards — two outside with the thumb groove and one inside. I have metal cards in all three slots, so it adds a little extra weight, but the magnet still holds firmly and stays aligned. The main section has a window for IDs. I keep two IDs and my insurance card there, and even with it being packed, the magnet still holds strong. One small downside: the window isn’t deep enough to fully show my ID, cutting off the date of birth at the bottom. I have to push my license up a bit, which looks a little goofy, but since I rarely need my ID, it’s not a big issue. When I do need it, I can at least show it without taking it out. The main compartment easily holds 6–8 cards. I’m currently maxed out at 7 cards, including 2 metal ones, and they all have flat surfaces. The push-up button slides smoothly even with the extra weight, and all the cards pop up as they should. The money clip is very secure too. I haven’t fully tested its limits, but it held a single bill in place without any issues, and right now I have 10 folded bills in there with no problem. Overall: I love this wallet. It’s compact, easy to access, and for the most part, the cards are very easy to grab.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2025

recommand products