Pay in installments of $51.25 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 23 - Sep 28
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Frizzled-4/FZD4 Fc Chimera Protein, HumanProduct Specification Species Human Antigen Frizzled 4 FZD4 Synonyms Fz 4, hFz4, Frizzled 4 Accession Q9ULV1 Amino Acid Sequence Phe37 Glu180, with C terminal Human IgG Fc
Product Specification
| Species | Human |
| Antigen | Frizzled-4/FZD4 |
| Synonyms | Fz-4, hFz4, Frizzled-4 |
| Accession | Q9ULV1 |
| Amino Acid Sequence | Phe37-Glu180, with C-terminal Human IgG Fc FGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEEIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Expression System | HEK293 |
| Molecular Weight | 50-55 kDa (Reducing) |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | Human Fc Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1.Hiroyuki Kirikoshi, Norihiko Sagara, Jun Koike, Katsuaki Tanaka, Hisahiko Sekihara, Momoki Hirai, Masaru Katoh. Molecular Cloning and Characterization of Human Frizzled-4 on Chromosome 11q14-q21. [J]. Biochemical and Biophysical Research Communications, 1999(3):955-961.2.Ke Zhang, Qun Lv, Liming Li, Mingjun Jiang, Fang Fang. Discovering the role of FZD4 Gene in human cutaneous squamous cell carcinoma.[G]. Indian Journal of Dermatology,2021-66-5-(484-489). |
Background
Frizzled 4 (FZD4) is an important receptor for WNT proteins that stimulate several downstream signaling pathways. The FZD4 gene has been mapped to human chromosome 11q14-q21. FZD4 spans a total of 7392 nucleotides and encodes a 537-amino-acid protein with the N-terminal cysteine-rich domain, seven transmembrane domains, and the C-terminal S/T-X-V motif. The FZD4 mRNA of 7.7 kb in size were detected almost ubiquitously in normal human tissues and larger amounts in fetal kidney, adult heart, skeletal muscle, and ovary. Among cancer cell lines, the FZD4 mRNA level was higher in HeLa S3. The FZD4-Wnt interaction is involved in many types of cancers. The role of FZD4 in cutaneous squamous cell carcinoma (CSCC) has not been well studied.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy