SKU: 29215330615

Human PIGF, His tag

Sale price$159.75 Regular price$177.50
Save 10%

Pay in installments of $44.38 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PIGF, His tagProduct Specification Species Human Synonyms PLGF Accession P49763 2 Amino Acid Sequence Protein sequence (P49763 2, Leu19 Arg149, with C 10*His) LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRRGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 16. 4kDa Actual: 30kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag

Product Specification


Species Human
Synonyms PLGF
Accession P49763-2
Amino Acid Sequence

Protein sequence (P49763-2, Leu19-Arg149, with C-10*His) LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRRGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 16.4kDa Actual: 30kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied. 

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles.

Background

Placental growth factor (PIGF) is a member of the VEGF (vascular endothelial growth factor) sub-family - a key molecule in angiogenesis and vasculogenesis, in particular during embryogenesis. The main source of PIGF during pregnancy is the placental trophoblast. PIGF is also expressed in many other tissues, including the villous trophoblast. Placental growth factor-expression within human atherosclerotic lesions is associated with plaque inflammation and neovascular growth. Serum levels of PIGF and sFlt-1 (soluble fms-like tyrosine kinase-1, also known as soluble VEGF receptor-1) are altered in women with preeclampsia.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 29215330615

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Doug Fitzpatrick
Battle Creek, US
★★★★★ 5
Quality filter.
Size: (Pack of 1)
I have been using these filters for years on my Grand Caravan. Wait till they go on sale and stock up on them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
G
Verified Purchase
Gregg Smith
Houston, US
★★★★★ 4
Good OEM replacement, but check the contents
Size: (Pack of 1)
This filter was perfect for my 2020 ram 1500, however I had to get a replacement because the gasket was not included in the box as delivered. I contacted the seller and they replaced it within two days. The replacement unit had both the filter, and the gasket in the box it should've been.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 27, 2025
P
Verified Purchase
pullitmans
Pawtucket, US
★★★★★ 5
Good price
Size: (Pack of 1)
Just as described, good price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
P
Verified Purchase
Potato
Whiting, US
★★★★★ 5
Well made filter.
Size: (Pack of 1)
High quality manufacture.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
R
Verified Purchase
Royce Green
Carnegie, US
★★★★★ 5
Exposing the Roots of Christian Nationalism
Format: eTextbook
Kevin M. Kruse’s One Nation Under God: How Corporate America Invented Christian America dismantles the enduring myth that the United States was founded as a “Christian nation.” Instead, Kruse demonstrates how this identity was deliberately constructed in the mid‑20th century as a political strategy. Beginning in the 1930s, business leaders alarmed by Franklin D. Roosevelt’s New Deal sought to counter what they perceived as government “slavery.” To resist these reforms, they partnered with clergy and promoted the idea of “freedom under God,” blending economic resistance with religious appeal. This alliance reached its zenith during Dwight Eisenhower’s presidency. Eisenhower expanded religion’s role in public life, inaugurating the National Prayer Breakfast, adding “under God” to the Pledge of Allegiance, and making “In God We Trust” the official national motto. These initiatives reshaped American identity, fueling a surge in church membership and embedding religious language into civic rituals. The phrase “one nation under God” became a widely accepted marker of patriotism, crossing political and denominational lines. Kruse’s central argument is that Christian nationalism was not inherited from the Founders but deliberately cultivated by corporate and political interests in the 20th century. By exposing its origins, he reveals how this “invented tradition” continues to shape and divide American politics today. C.S. Lewis, in The Screwtape Letters, anticipated this danger with remarkable clarity. He warned that the gravest temptation is not outright disbelief but the subtle corruption of faith—when Christianity is treated as a means to another end rather than as an end in itself. Lewis’s insight resonates with Kruse’s account: both show how faith can be co‑opted when believers confuse God’s kingdom with Caesar’s. History is important, but it is equally important that we do not allow bad history to repeat—or even to rhyme—when each stanza leads us further from God. Kruse provides the historical scaffolding, Lewis the theological discernment. Together they invite us to vigilance: to name the temptations of Christian nationalism, to resist its allure, and to anchor our communities in the truth that God’s kingdom cannot be co‑opted by worldly power.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 16, 2025

recommand products