SKU: 3024916792

Human MUC4, his tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 18 - Sep 23

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human MUC4, his tagProduct Specification Species Human Synonyms Ascites sialoglycoprotein (ASGP), Pancreatic adenocarcinoma mucin, Testis mucin, Tracheobronchial mucin Accession Q99102 Amino Acid Sequence Protein sequence (Q99102, Trp4683 Ser4918, with C 10*His)

Product Specification


Species Human
Synonyms Ascites sialoglycoprotein (ASGP), Pancreatic adenocarcinoma mucin, Testis mucin, Tracheobronchial mucin
Accession Q99102
Amino Acid Sequence

Protein sequence (Q99102, Trp4683-Ser4918, with C-10*His) WMFGDPHITTLDGVSYTFNGLGDFLLVGAQDGNSSFLLQGRTAQTGSAQATNFIAFAAQYRSSSLGPVTVQWLLEPHDAIRVLLDNQTVTFQPDHEDGGGQETFNATGVLLSRNGSEVSASFDGWATVSVIALSNILHASASLPPEYQNRTEGLLGVWNNNPEDDFRMPNGSTIPPGSPEEMLFHFGMTWQINGTGLLGKRNDQLPSNFTPVFYSQLQKNSSWAEHLISNCDGDSSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 27.3 kDa Observed MW: 35-50 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Mucin-4 (MUC-4) is a mucin protein that in humans is encoded by the MUC4 gene. MUC-4 is a high-molecular weight glycoprotein. This gene encodes an integral membrane glycoprotein found on the cell surface, although secreted isoforms may exist. At least two dozen transcript variants of this gene have been found, although for many of them the full-length transcript has not been determined or they are found only in tumor tissues. MUC-4 has been found to play various roles in the progression of cancer, particularly due to its signaling and anti-adhesive properties which contribute to tumor development and metastasis. It is also found to play roles in other diseases such as endometriosis and inflammatory bowel disease.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 3024916792

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Ariel B.
Fort Morgan, US
★★★★★ 4
Heavy linen character, but a beautifully tailored suit!
Color: Beige, Size: 4, Color: Beige, Size: 4
This is a really nice linen suit! The jacket is beautifully made and well-tailored, with a fun speckled texture that has lots of pretty color variation (we ordered the beige). When I placed it side by side with a similar linen suit from another brand, the difference in the linen texture was really noticeable — this had a much stronger linen character that stands out! It has three useful pockets on the outside of the jacket, which is great for little hands. The only downside is that one of the inside pockets is just for show (faux), which was a bit surprising and somewhat disappointing for my little guy. The pants have pockets too, but they aren’t very deep — perfect for small treasures, but not much more. The pants are made from a lighter, thinner single-layer linen compared to the fully lined, double-layer jacket, which makes sense for comfort and easy movement. The pants didn’t come with a front crease ironed in, so you’ll want to press one yourself. The linen did pick up some creases from being folded in the package, but it doesn’t seem quite as wrinkly as some other linen fabrics I’ve tried. Still, like most linen clothes, especially for boys, the pants will need occasional ironing to keep them looking neat and crisp, especially after a day of play and general wear. The structured, lined jacket stays looking smoother and more put-together with less effort. It also came with a bow tie, a neck tie, and a tuxedo-style white shirt as extras. The ties aren’t great quality — they’d work fine for quick photos but probably won’t hold up to much actual wear. The formal white shirt feels a bit funny paired with the casual linen suit, but I don’t mind at all. We already have white shirts that we prefer, so we’ll use those instead. For us, the extras are really just bonus items we won’t plan on using. Overall, it’s a handsome little suit that’s perfect for special occasions like weddings, family photos, or holiday events. My kid looked adorable in it! The stronger linen texture on the jacket gives it a premium feel that I really like. Just be ready for a bit of extra care with the pants to keep everything sharp.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2026
C
chzgr8er
Dallas, US
★★★★★ 5
Great suit set
Color: Light Grey, Size: 4
It is incredibly attractive and includes everything a young child needs for a special occasion. The material is a 75% polyester and 25% linen blend, and the outer fabric feels remarkably smooth. Its unstructured design allows for an attractive, natural drape, and the blend conveniently allows for machine washing at home. As is typical with linen-based materials, the fabric can be naturally stiff and prone to wrinkling, so I recommend ironing or steaming it before use. The lightweight feel makes it an excellent choice for the spring, summer, and fall months. Overall, this suit offers exceptional value for the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 12, 2026
J
Verified Purchase
Joseph
Grantham, US
★★★★★ 5
A good First Communion suit
Size: 6, Color: White, Size: 6, Color: White
This suit looks and feels really nice even though it’s not 100% linen. My son is an average size 7 year old, but I got a size 6 so that the fit would be nice and snug and not loose and baggy. It was the right choice. Comes with a bow tie which is nice, a tie (which is very cheap and poorly made) and a pocket square.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
C
Verified Purchase
Cheila
Lexington, US
★★★★★ 5
Very stylish💜💜
Size: 6, Color: Light Blue, Size: 6, Color: Light Blue
This little suit for boys is very stylish. I bought it for my grandson for a wedding occasion and it looked very nice. The fabric is not too thick so for the summer wedding it was great. I pick the blue color and it looked fantastic!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 16, 2026
T
Verified Purchase
Teresa Stevens
Natrona Heights, US
★★★★★ 5
Loved it
Fit perfectly
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 9, 2025

recommand products