SKU: 34537498061

Human IL-4 , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 10 - Sep 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-4 , His tagProduct Specification Species Human Synonyms B cell stimulatory factor 1 (BSF 1), Binetrakin, Lymphocyte stimulatory factor 1, Pitrakinra Accession P05112 Amino Acid Sequence Protein sequence(P05112, His25 Ser153, with C 10*His) HKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSSGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 16. 6kDa Actual: 20kDa

Product Specification


Species Human
Synonyms B-cell stimulatory factor 1 (BSF-1), Binetrakin, Lymphocyte stimulatory factor 1, Pitrakinra
Accession P05112
Amino Acid Sequence

Protein sequence(P05112, His25-Ser153, with C-10*His) HKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Theoretical:16.6kDa Actual:20kDa

Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The interleukin 4 (IL4, IL-4) is a cytokine that induces differentiation of naive helper T cells (Th0 cells) to Th2 cells. Upon activation by IL-4, Th2 cells subsequently produce additional IL-4 in a positive feedback loop. IL-4 is produced primarily by mast cells, Th2 cells, eosinophils and basophils. It is closely related and has functions similar to IL-13. Interleukin 4 has many biological roles, including the stimulation of activated B cell and T cell proliferation, and the differentiation of B cells into plasma cells. It is a key regulator in humoral and adaptive immunity. IL-4 induces B cell class switching to IgE, and up-regulates MHC class II production. IL-4 decreases the production of Th1 cells, macrophages, IFNγ, and dendritic cells IL-12. IL-4 has also been shown to drive mitogenesis, dedifferentiation, and metastasis in rhabdomyosarcoma. IL-4, along with other Th2 cytokines, is involved in the airway inflammation observed in the lungs of patients with allergic asthma.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 34537498061

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jeff Stokes
Waukegan, US
★★★★★ 3
Good Space Savings, but the Bag Zippers don't hold very well
Size: 15 Combo Travel Size
I purchased these Vacbird travel vacuum bags mainly to save space in carry-on luggage and cruise packing, and the overall concept works well. The included rechargeable air pump is compact and convenient for travel, and the compression bags can significantly reduce the amount of space taken up by clothing and soft items when sealed properly. The bags themselves are easy to fill and compress, and they can definitely help organize luggage more efficiently for longer trips. For bulky clothing like jackets, sweatshirts, or extra layers, the space savings are noticeable. The rechargeable pump is also more convenient than manually rolling air out of the bags repeatedly. The reason this isn’t a higher rating is the zipper closure quality. The zippers feel much weaker than they should for a product designed around repeated compression and travel handling. Several closures required extra care to avoid separating or leaking air, which reduces confidence in long-term durability. The system works, but the zipper design feels like the weak point and keeps the product from feeling as reliable as it otherwise could be.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
K
Verified Purchase
kaity
Dallas, US
★★★★★ 5
Small fan, serious power
Color: Black
I bought the Honeywell Turboforce Fan for my bedroom, and I’m honestly impressed with how powerful this little thing is. Don’t let the compact size fool you — it moves a lot of air. On the lowest setting it’s perfect for a gentle breeze while sleeping, and the higher settings can easily cool down a medium-sized room or help circulate AC much more efficiently. The 90-degree pivoting head is a great feature. I can angle it upward for better air circulation or point it directly at me when it’s extra hot. It’s lightweight, easy to move around, and doesn’t take up much space on a desk or nightstand. It can also be wall-mounted, which is a nice bonus. Noise level is reasonable. On low, it’s actually a pleasant white noise. Medium and high are louder, but not in an annoying way — just the sound of strong airflow. Build quality feels solid for the price, and it’s been running daily without any issues. For the cost, this fan seriously overperforms. If you need a compact, affordable, and powerful fan, this is a no-brainer. I’d absolutely buy it again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026
G
Verified Purchase
Gianluca
Fort Morgan, US
★★★★★ 5
Great price and very quiet
Color: Black
I use the Honeywell TurboForce HT-900 in my home office to help with airflow around my computer setup, and it’s been a solid performer for the price. Despite its small size, it moves a surprising amount of air. On high, it pushes a strong, focused stream that actually reaches across the room. Medium is what I use most often since it balances good circulation with reasonable noise, and low is quiet enough to run in the background without being distracting. Noise levels are generally acceptable. Low and medium are fairly quiet with a consistent hum, while high is noticeably louder but still not unbearable for short bursts. It’s also very simple to position and use. The head tilts easily, so you can aim airflow exactly where you need it, and the compact size makes it easy to place on a desk without taking up much space. Overall, it’s a straightforward, no-frills fan that does its job well. Strong airflow, simple controls, and good value for the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
B
Verified Purchase
Brandy Mullane
Cuba, US
★★★★★ 5
Powerful and long lasting
Color: Black
I purchased a blue colored one in May 2022 and it finally went out a few days ago. I ran this thing almost constantly as im going through menopause and it came to be a staple at my bedside. 4 years of running ALL THE TIME! Great little fan with a ton of airflow to keep me cool during night sweats. And it has just enough white noise to distract from outside noise. Also, the motor power never differentiated after using for so long. It was still strong. I just ordered another one to replace it and cant wait for it to arrive so I can sleep again! Only thing is they only have bakck or white instead of blue this time but thats ok as long as it performs.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
M
Verified Purchase
Morocco Victor Parker
Los Angeles, US
★★★★★ 4
Small fan, serious power
Color: Black
I bought the Honeywell Turboforce Fan for my bedroom, and I’m honestly impressed with how powerful this little thing is. Don’t let the compact size fool you — it moves a lot of air. On the lowest setting it’s perfect for a gentle breeze while sleeping, and the higher settings can easily cool down a medium-sized room or help circulate AC much more efficiently. The 90-degree pivoting head is a great feature. I can angle it upward for better air circulation or point it directly at me when it’s extra hot. It’s lightweight, easy to move around, and doesn’t take up much space on a desk or nightstand. It can also be wall-mounted, which is a nice bonus. Noise level is reasonable. On low, it’s actually a pleasant white noise. Medium and high are louder, but not in an annoying way — just the sound of strong airflow. Build quality feels solid for the price, and it’s been running daily without any issues. For the cost, this fan seriously overperforms. If you need a compact, affordable, and powerful fan, this is a no-brainer. I’d absolutely buy it again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026

recommand products