Pay in installments of $75.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 8 - Sep 13
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
LILRB3/CD85a/ILT5 His Tag Protein, HumanProduct Specification Species Human Accession O75022 Amino Acid Sequence Gly24 Glu443, with C terminal 8*His
Product Specification
| Species | Human |
| Accession | O75022 |
| Amino Acid Sequence | Gly24-Glu443, with C-terminal 8*His GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLEGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 60-75kDa (Reducing) |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
LILRB3 is a member of LILRB family that is restrictively expressed on myeloid cells, including monocytes, neutrophils, eosinophils, and basophils (as well as on in vitro differentiated mast cells and osteoclasts). LILRB3 contains four cytoplasmic ITIM motifs hat may contribute to negative regulation of immune response. Ligation of LILRB3 in human myeloid cells led to inhibition of immune activation. LILRB3 may be an inhibitor of allergic inflammation and autoimmunity. However, the ligand for LILRB3 has not been identified, and the downstream signaling of LILRB3 is unclear. It is noteworthy that LILRBs, including LILRB3, are primate specific.
LILRB3 is also expressed on some myeloid leukemia, B lymphoid leukemia, and myeloma cells. It is reportedly co-expressed with stem cell marker CD34 and with myeloma marker CD138.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.1 ★★★★★
Based on 21 reviews
Sort
Product Reviews
★★★★★ 5
Survives 7 months so far.
Color: Christmas Consuela, Size: Large Dog
It is still intact after nearly 7 months of constant play. My blue heeler normally destroys toys in just a few weeks.
Consuela has exceeded expectations of survival with an extremely chewy, destruction prone dog.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2026
★★★★★ 4
Short-lived but much enjoyed as a chew toy
Color: Consuela the Cactus - Large, Size: Large Dog
I bought two of these for my "granddogs" in the size for Large dogs. The German Shepherd-mix stole the one intended for the border collie-mix and had both toys halfway destroyed within a day--I'm pretty sure they didn't survive much longer after that. Much enjoyed! Maybe I should've bought the Extra Large size, because the Large barely fit in her mouth and she wanted to play tug-of-war, so there wasn't much for me to grab onto. Then the border collie wanted in on the action (she's older, so she needed help tugging!) but there wasn't enough material for her to grab onto without accidentally sinking her teeth into me instead.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 9, 2025
★★★★★ 5
Best dog toy!
Color: Air Head, Size: Large Dog, Color: Air Head, Size: Large Dog
I got this toy for my dog who loves squeakers not only is it a two in one it actually has three toys inside which I think is amazing!! 10/10 recommend
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 11, 2026
★★★★★ 5
Love all the Barkbox toys
Color: Christmas Consuela, Size: Large Dog
This is our third "Consuela"! Our dogs LOVE these toys, and they are the most durable we can find for our heavy chewers. They really like the ball inside as well. Highly, highly recommend these toys. I won't be buying other toys anymore, just barkbox.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 27, 2026
★★★★★ 5
My dog is a toy destroyer
Color: Consuela the Cactus - Large, Size: Large Dog, Color: Consuela the Cactus - Large, Size: Large Dog
I’ve had a hard time trying to find toys that my dog, Zara loves because she’s actually very picky. Ive gotten plenty of Kong toys that are well known to be indestructible but she wants nothing to do with them. Then I got her ropes and that seemed to be good for a while until she was getting sick in the middle of the night from eating all of the string. Stuffed toys aren’t good because she’ll rip them within seconds and eat all of the stuffing. I felt like I’ll never score the perfect toy for her.
I found the three layered cactus toy and decided to give it a go. It’s clearly designed to be ripped and destroyed to get the ball in the middle which is actually really cute and fun to see all of the layers.
The cactus arms have stuffing and of course that’s the first thing she went for and ate. I had to watch her and make sure I took the stuffing away before she ate it. And before I knew it, she ate half of the first layer fabric lol once she got through the first layer, all she’s been doing is walking around the house with the toy in her mouth. But now she’s tired and passed out on the couch from all of the fun.
This toy won’t last long with a toy destroyer but it sure does give them something to do and it’s a cute toy. I do recommend!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 26, 2024
recommand products
Metro Super Erecta PRO 4 Tier Mobile Polymer Mat Shelving - 21 x 54 x 74" PR.M4T68.2154
674.85
Heavy Georgette Fabric Brown Color Readymade Gown With Dupatta
54.27
Cream Color Art Silk Fabric Engaging Saree With Printed Work
46.20
Metro 24 x 48 Three-Sided Double Snake Frame SF55NK3
101.20
Metro Super Erecta PRO 4 Tier Polymer Mat Shelving - 21 x 72 x 74" PR.4T74.2172
597.30