SKU: 36553995108

Biotinylated CD155/PVR His&Avi Tag Protein, Human

Sale price$234.00 Regular price$260.00
Save 10%

Pay in installments of $65.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 27 - Oct 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated CD155/PVR His&Avi Tag Protein, HumanProduct Specification Species Human Synonyms PVR, FLJ25946, PVS, CD155, TAGE4, HVED, NECL5 Accession P15151 Amino Acid Sequence Trp21 Asn343, with C terminal 8*His&Avi tag

Product Specification


Species Human
Synonyms PVR, FLJ25946, PVS, CD155, TAGE4, HVED, NECL5
Accession P15151
Amino Acid Sequence

Trp21-Asn343, with C-terminal 8*His&Avi tag WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRNIEGRMDHHHHHHHHGLNDIFEAQKIEWHE

Expression System HEK293
Molecular Weight

65-75kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Biotin
Tag Avi Tag, His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Kučan Brlić P. et al. (2019) Targeting PVR (CD155) and its receptors in anti-tumor therapy. Cell Mol Immunol. 16(1): 40-52.

Background

CD155 is a member of the immunoglobulin superfamily also known as the human receptor for poliovirus (PVR). The full length (or PVR alpha isoform) is synthesized as a 417 amino acid (aa) precursor that contains a 20aa signal sequence, a 323aa extracellular region, a 24aa TM segment and a 50aa cytoplasmic tail. It has been demonstrated that CD155 can be recognized and bond by DNAM-1 and CD96 which promote the adhesion, migration and NK-cell killing, and thus efficiently prime cell-mediated tumor-specific immunity. CD155 is expressed at high levels in several human malignancies and seems to have pro tumorigenic and therapeutically attractive properties that are currently being investigated in the field of recombinant oncolytic virotherapy. More intriguingly, PVR participates in a considerable number of immunoregulatory functions through its interactions with activating and inhibitory immune cell receptors. These functions are often modified in the tumor microenvironment, contributing to tumor immunosuppression.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 36553995108

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
KevMeist
Charlottesville, US
★★★★★ 5
Excellent device, see my use case in the review.
Color: Grey
I got the hub in two days ago. I plugged it in to a uni-directional HDMI cable (I have used these for years from Monoprice.com) from the hub to the TV and the PD port into the charging block. Charging started but the iPad Pro screen was NOT showing on the TV. I switched in a regular HDMI cable from the hub to the TV and it worked. The Monoprice cables have some sort of logic in the cable ends allowing a very thin HDMI cable. I have used these on my TVs at home and when teaching at a senior facility for at least 8 years now. So, something with the unidirectional HDMI cables seems to interfere with this hub but “regular” HDMI cables seem OK. Before buying this hub, I had emailed Anker TS with a question. Anker turned around 3 emails with answers in just over an hour. This is one of the reasons why I have bought quite a lot of Anker products over the years. My use for this is to plug in my iPad Pro to my AVR so that I can stream stuff to my TV while simultaneously charging the iPad at the same time. This works well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 16, 2025
C
Verified Purchase
C. Rypkema
Lexington, US
★★★★★ 5
Works great and handles everything.
Color: Black
Works great. I plug in a standalone video camera for meetings, a keyboard & trackball, and monitor with a couple of other slots open, like for a portable CD-ROM/DVD player. One plug into the laptop and everything is connected. Initially, I bought another hub, but that one didn't consistently work. This one does. In a month of heavy use, I've had no issues with it at all.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
Z
Verified Purchase
Zane
Grantham, US
★★★★★ 5
Helped transfer data from Samsung Galaxy S21 with broken screen.
Color: Black
Helped me transfer data from a Samsung Galaxy S21 with broken screen. Simple put USB C end into phone , grab HDMI cable and plug into hub , then plug HDMI end into a monitor. Then grab a wireless keyboard & mouse and plug dongle into hub. Your phone will output to monitor and you can transfer data via Smart Switch using keyboard & mouse. Will only work if phone is unlocked I found on S21.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
B
Verified Purchase
B. Johnson
Pawtucket, US
★★★★★ 5
good so far!
Color: Black
Seems to work fine so far. The last one - different brand - had a bad connection and Im hopefully as I do always find Anker to be of good quality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
S
Verified Purchase
Stacey B
Carnegie, US
★★★★★ 5
Great Slim iPad Case – Secure Fit & Easy to Use
Color: Black, Size: ipad 9th/ 8th/ 7th gen 10.2 inch, Color: Black, Size: ipad 9th/ 8th/ 7th gen 10.2 inch
This is a really nice iPad case and worked perfectly as a replacement for my old one that was falling apart. I have an Apple iPad 9th Generation (10.2 inch), and this case fit perfectly. The cutouts for the camera, volume buttons, power button, and charging port all line up exactly as they should. The iPad snaps into the case easily by gently pressing it into the rounded corners, and once installed it feels very secure with no slipping or falling out. The case is very lightweight also. I also had no issues accessing or using any of the buttons while the case was on. One of my favorite features is the automatic sleep/wake function—closing the cover puts the iPad into sleep mode, which helps save battery life. I chose the black version, and it has a clean, simple look. For the price, I think it’s a great value. Overall, this is a slim, functional, and well-fitting iPad case that I definitely recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026

recommand products