SKU: 3725431516

Human CD81 , His tag

Sale price$166.50 Regular price$185.00
Save 10%

Pay in installments of $46.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD81 , His tagProduct Specification Species Human Synonyms 26 kDa cell surface protein TAPA 1, Target of the antiproliferative antibody 1, Tetraspanin 28 (Tspan 28), TAPA1, TSPAN28 Accession P60033 Amino Acid Sequence Protein sequence(P60033, Phe113 Lys201, with C 10*His) FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKGGGGSHHHHHHHHHH Expression System CHO Molecular Weight Theoretical: 11. 4kDa Actual: 10kDa Purity 95% by

Product Specification


Species Human
Synonyms 26 kDa cell surface protein TAPA-1, Target of the antiproliferative antibody 1, Tetraspanin-28 (Tspan-28), TAPA1, TSPAN28
Accession P60033
Amino Acid Sequence

Protein sequence(P60033, Phe113-Lys201, with C-10*His) FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKGGGGSHHHHHHHHHH

Expression System CHO
Molecular Weight Theoretical:11.4kDa Actual:10kDa
Purity >95% by SDS-PAGE
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD81 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. It is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. Studies showed that this protein plays a critical role in Hepatitis C attachment and/or cell entry by interacting with virus' E1/E2 glycoproteins heterodimer. It also appears to play a role in liver invasion by Plasmodium species. Meanwhile, CD81 is required for Plasmodium vivax sporozoite entry into human hepatocytes and for Plasmodium yoelii sporozoite entry into murine hepatocytes.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 3725431516

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Brian Reaves
Pawtucket, US
★★★★★ 5
A huge book that gives you the hero's beginnings.
Format: Hardcover
I own several Marvel Omnibus collections (Captain America, Miller's Daredevil run, etc) but I have to say I think this one is the biggest in terms of thickness. This has a serious page count, and is definitely worth the money you spend on it for size alone. Those coming off the Wolverine movie and interested in more of his back-story will enjoy most of this. The stories here are not put together in chronological order of publication, but rather in chronological order of when it supposedly happened in his life. That being said, it's odd that Marvel chose to leave out "Origin", since that six-part story would have made an obvious choice for the beginning of this collection. Instead, we start out with a number of "Weapon X" stories that are supposed to set the stage for his creation into a weapon. The stories are not easy to follow for a casual read, however. You'll have to invest time reading dozens of dialogue balloons over the constantly-resting pose of Logan with wires coming out of him. Not the best start they could have hoped for, but I can see the logic of it. The Wolverine/Kitty Pryde miniseries is also here for some reason. I guess its inclusion into the collection is for completist purposes, but it's not that great. Eventually, you reach the Frank Miller Wolverine mini-series that started it all and paved the way for his solo series later on. If you've read that one, you know it's a classic as we get more back story into his Samurai/Ninja training past (and it's also rumored to be the basis for the second Wolverine solo film if it gets made). This leads into the first 10 issues of his solo series as we meet Logan's "Patch" identity, his weird black "facepaint mask" costume, and the dark dealings of Madripor. The colors here are rich and vibrant. Those who were disappointed with the washed-out look of the "Essentials" collection of Wolverine stuff will find nothing but happiness here. The price is reasonable for what you're getting here. Let me say again though that this is a MONSTER of a book, so you won't be carrying this around for a casual read at the coffee shop. This is more along the lines of a serious collector book than those Essential volumes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2009
I
Verified Purchase
Ian
Lake Worth, US
★★★★★ 5
A bloody walk down memory lane.
Format: Hardcover
This massive volume collects all of Wolverine's earliest stories from his very violent history. Instead of being collected chronologically in order of first appearance, this book tells Logan's painful story as it happened to him. Beginning with Marvel Comics Presents #1-10; we see the excruciating process that turned him into Weapon X. After that, it's his first appearance in Incredible Hulk #180-182. That's followed up by the classic 4-issue Chris Claremont/ Frank Miller miniseries, and X-Men #172-173. We also Kitty Pryde and Wolverine #1-6, Captain America annual 8, Spider-Man vs. Wolverine, Punisher War Journal 6-7 and Wolverine #1-10, amongst others. This book is currently out of print, so good luck finding a copy. If you track one down, expect to pay a pretty penny for it, as I did. As a Wolverine fan, however, this is a must-have collection
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 19, 2015
K
Verified Purchase
Kenneth Robert Jensen
New York, US
★★★★★ 5
Excellent book
Came ASPA good thing to, I wanted to read vol 1 before vol 2 drops. This book doesn’t disappoint if your fan of X-men, Wolverine, or even the Hulk it includes almost everything about the character his origin story to his first appearance. Most marvel omnibus are thick books and for price I paid it did not let me down.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 26, 2021
T
Verified Purchase
timothy Kocsis
Phoenix, US
★★★★★ 5
The best he is at what he does!!!!
This is the start of Wolverine gang!! I own all of this in other editions but got this for the display factor and it looks great!!! Nice to have it all together!!!! Love the Spider-Man vs Wolverine issue included!!! Cheers!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2021
I
Verified Purchase
ian
Lowell, US
★★★★★ 5
Wolverine he's the best at what he does and what he does isn't very nice
Fantastic book definitely worth getting whether you are an x men fan or a wolverine or simply just looking for classic stories
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 7, 2020

recommand products