SKU: 39043423522

Biotinylated LILRB3/CD85a/LIT5 Fc&Avi Tag Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 7 - Sep 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated LILRB3/CD85a/LIT5 Fc&Avi Tag Protein, HumanProduct Specification Species Human Synonyms LILRB3, CD85a, ILT5 Accession O75022 Amino Acid Sequence Gly24 Glu443, with C terminal human IgG1 Fc&Avi tag

Product Specification


Species Human
Synonyms LILRB3, CD85a, ILT5
Accession O75022
Amino Acid Sequence Gly24-Glu443, with C-terminal human IgG1 Fc&Avi tag GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLEIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE
Expression System HEK293
Molecular Weight 85-95kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Biotin
Tag Human Fc Tag, Avi Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Kang X. et al. (2016) Inhibitory leukocyte immunoglobulin-like receptors: Immune checkpoint proteins and tumor sustaining factors. Cell Cycle. 15(1): 25-40.

Background

LILRB3 is a member of LILRB family that is restrictively expressed on myeloid cells, including monocytes, neutrophils, eosinophils, and basophils (as well as on in vitro differentiated mast cells and osteoclasts). LILRB3 contains four cytoplasmic ITIM motifs hat may contribute to negative regulation of immune response. Ligation of LILRB3 in human myeloid cells led to inhibition of immune activation. LILRB3 may be an inhibitor of allergic inflammation and autoimmunity. However, the ligand for LILRB3 has not been identified, and the downstream signaling of LILRB3 is unclear. It is noteworthy that LILRBs, including LILRB3, are primate specific. LILRB3 is also expressed on some myeloid leukemia, B lymphoid leukemia, and myeloma cells. It is reportedly co-expressed with stem cell marker CD34 and with myeloma marker CD138.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 39043423522

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Carnegie, US
★★★★★ 5
Wow!
Format: Hardcover
This text is so fascinating. I was hesitant to make this purchase based on the price alone, but it is so worth it if you want to understand Existential Psychotherapy. Yalom, as many will already know, is a titan in the field of existential psychotherapy. This is a text that is from one of the fields most well-respected experts. Its also filled with a lot of content which makes the price tag certainly worth it. You'll likely walk away feeling like you got your money's worth and much more. Highly recommend
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 19, 2024
R
Verified Purchase
Renee
Bozeman, US
★★★★★ 5
Helps With Dry Mouth, Tastes Great and Easy to Keep On Hand
Size: 27 Count (Pack of 1), Size: 27 Count (Pack of 1)
Update: I have already repurchased more! I love the taste and they work so well with a great taste. I’ve been dealing with dry mouth lately, especially at night, and these Biotene Dry Mouth Lozenges have been really helpful. They dissolve slowly and help keep my mouth feeling more comfortable without being overly sweet or strong. The mint flavor is light and refreshing, which I appreciate because some lozenges can taste too medicinal. These are gentle and easy to use throughout the day or before bed if dryness is bothering me. The packaging is also convenient to keep in a bag or on a bedside table. I like that the lozenges are sugar-free and individually sealed in the blister pack so they stay fresh. I included a photo of the lozenge in my hand so you can see the size and what it looks like out of the package, along with photos of the box and blister pack for reference. These are simple, effective, great taste and a good option to keep on hand if you deal with dry mouth.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 12, 2026
D
Verified Purchase
Debra Lemacks
Boise, US
★★★★★ 5
It works and nice mint taste
Size: 27 Count (Pack of 1)
Very good for dry mouth.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026
L
Verified Purchase
Lisa Case
Port Orchard, US
★★★★★ 5
Works great
Size: 27 Count (Pack of 1)
Helps with dry mouth alot
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
N
Verified Purchase
NRich
Chelsea, US
★★★★★ 4
Would continue to buy again
Size: 27 Count (Pack of 1)
Purchased twice. I wish they made these bigger. Moisturizing mouth well and flavor is pleasant and long lasting. I have Sjogrens and suffer with dry eye and mouth. These work better than regular lozenges.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2026

recommand products