Pay in installments of $26.25 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 17 - Aug 22
For Your Every Summer RSVP, with Code: SUMMER15
Description
CTLA-4 His Tag Protein, HumanProduct Specification Species Human Synonyms Cytotoxic T lymphocyte associated protein 4 Accession P16410 Amino Acid Sequence Ala37 Phe162, with C terminal 10*His AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight 20 27kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical
Product Specification
| Species | Human |
| Synonyms | Cytotoxic T-lymphocyte-associated protein 4 |
| Accession | P16410 |
| Amino Acid Sequence | Ala37 - Phe162, with C-terminal 10*His AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 20-27kDa (Reducing) |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
Cytotoxic T-lymphocyte-associated protein 4 (CTLA-4) is an inhibitory receptor belonging to the CD28 immunoglobulin subfamily, expressed primarily by T-cells. The family includes CD28, CTLA-4 and ICOS as well as other proteins including PD-1, BTLA and TIGIT.Its ligands, CD80 and CD86, are typically found on the surface of antigen-presenting cells and can either bind CD28 or CTLA-4, resulting in a costimulatory or a co-inhibitory response, respectively. Because of its dampening effect, CTLA-4 is a crucial regulator of T-cell homeostasis and self-tolerance. The mechanisms by which CTLA-4 exerts its inhibitory function can be categorized as either cell-intrinsic (affects the CTLA-4 expressing T-cell) or cell-extrinsic (affects secondary cells). CTLA-4 mainly acts in a cell-extrinsic manner via its competition with CD28, CTLA-4-mediated trans-endocytosis of CD80 and CD86, and its direct tolerogenic effects on the interacting cell.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.5 ★★★★★
Based on 29 reviews
Sort
Product Reviews
★★★★★ 5
Five Stars
Format: Paperback
good job
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 5, 2018
★★★★★ 4
A Book For Audio
Format: Audiobook
The Art of Storytelling from Parents to Professionals is the first book that I can be confident in saying is better as an audio version than it would be in a paper or Kindle form because you can here the verbal inflections and the storytellers can change character, voice much easier than the printed word might. It also captures the listeners attention as the author herself can connect in a lot more personal and intimate way.
My concern is while I can understand what the author is getting at, I am not aspiring to be an oral performance style storyteller and there was not enough of a reach out from the world of oral storytelling to the written story. I mean how many of us are going to get up on stage and tell stories? I guess you can take the skills from one realm and use them elsewhere, but the connection may not be made so easily.
This was an audiobook that I had a lot of fun with, even if I didn’t quite get what I was hoping for from it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 10, 2020
★★★★★ 5
Great Overview of the Art of Storytelling
Format: Audiobook
I chanced on this as an Audible "freebie" to keep on the list for when I was out of credits. Well, it's excellent, and well worth the listen. And excellent survey of the topic spanning topics of performance (preparing, voice, body language, projection), various aspects of framing (culture, age, ethnicity, audience size), story structure and so on
This point is for Hannah B. Harvey, if perchance she reads tese reviews. One point of modern storytelling and writing that is not brought out in your lectures, is that some of the best villain/antagonists are actually the heroes/protagonists of their own stories. This is tangentially alluded to in talking about story viewpoints, but not to the extent that it can be an entirely new story, as Wicked and Maleificent turned The Wizard of Oz and Sleeping Beauty on their heads. And even in the 1960's, many a Bond 007 villain was trying to create what they imagined to be a better world. It's useful to consider in storytelling, as far too many people have forgotten/fail to see the fundamental moral ambiguities of life, and I suspect that goes a long way to explaining the extreme partisanship we see in the world today.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 17, 2023
★★★★★ 3
Sadly, I found the tips and the examples in this lecture to be very simplistic and uninspiring.
Format: Audiobook
I expected a professional storyteller to be able to keep my interest but I found the presentation to be quite boring. I got nothing out of it that I didn’t already know from just being an avid reader. It felt like a high school lecture. Sigh!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 15, 2019
★★★★★ 5
Great course on how to improve your storytelling abilities
Format: Audiobook
Storytelling is a great way to get a point across, and most of us digest information through stories. But when it comes time to tell a story, most of us don't have the skills to make the story engaging or impactful. That's where this course on storytelling comes in. You'll get good pointers on vocabulary, body language, tone, along with deeper pointers about how to shape the view of the story and how to refine its characters. It's all very detailed but it's all very interesting and well worth it. This course will help you see how useful storytelling can be in your personal and professional life, especially if you're in a field where you have to do a lot of public speaking.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 21, 2021
recommand products
10-15 Jaguar XKR XK X150 Rear Axle Wire Wiring Harness 8W839L468AC OEM
62.95
Captivating Portrait of Erik Satie: A Minimalist Masterpiece in Contemporary Art - Perfect for Home Decor & Unique Gifts
24.00
OPTOMA FX.PQ484-2401 Compatible Module with Original Bulb, Applicabler Projectors: S2010 , Alt. LampPart Number: BL-FU190C
193.32
OPTOMA DE.5811116701 Compatible Module with Original Bulb, Applicabler Projectors: OPX4540
380.75
98-03 Jaguar XJR XJ8 VDP X308 Hood Lid Lift Support Cylinder Strut Set of 2 OEM
54.37