SKU: 41820793000

H5N1 HA (A/Hong Kong/483/97) His Tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 12 - Sep 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

H5N1 HA (A/Hong Kong/483/97) His TagProduct Specification Species H5N1 Antigen HA Hemagglutinin Synonyms Hemagglutinin, HA Accession O92930 Amino Acid Sequence Ser405 Val520, with N terminal 8*His HHHHHHHHGGGSSGEQGVKGEKGERGENSVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQIWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV Expression System HEK293 Molecular Weight 72 80 43 55 25 30kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical

Product Specification


Species H5N1
Antigen HA/Hemagglutinin
Synonyms Hemagglutinin, HA
Accession O92930
Amino Acid Sequence

Ser405-Val520, with N-terminal 8*His

HHHHHHHHGGGSSGEQGVKGEKGERGENSVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQIWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV


Expression System HEK293
Molecular Weight 72-80 43-55 25-30kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

·12 months from date of receipt, -20 to -70 °C as supplied. 

·1 month, 2 to 8 °C under sterile conditions after reconstitution.  

·Please avoid repeated freeze-thaw cycles.

Reference

1.Michal Lazniewski, M. et al. (2018) Briefings inFunctional Genomics 17:415.

2. Sriwilaijaroen, N. and Suzuki, Y. (2012) Proc. Jpn. Acad. Ser. B. Phys.Biol Sci. 88:226.

3. Chang, Y.J. et al. (2021) Sci Rep 11:8637.


Background

Neuraminidase (NA) and hemagglutinin (HA) are major membrane glycoproteins found on the surface of influenza virus. Hemagglutinin binds to the sialic acid-containing receptors on the surface of host cells during initial infection and at the end of an infectious cycle. Hemagglutinin also plays a major role in the determination of host range restriction and virulence. As a class I viral fusion protein, hemagglutinin is responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Binds to sialic acid-containing receptors on the cell surface, bringing about the attachment of the virus particle to the cell. This attachment induces virion internalization either through clathrin-dependent endocytosis or through clathrin- and caveolin-independent pathway. Plays a major role in the determination of host range restriction and virulence. Class I viral fusion protein. Responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low pH in endosomes induces an irreversible conformational change in HA2, releasing the fusion hydrophobic peptide. Several trimers are required to form a competent fusion pore.




Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 41820793000

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Julie Lincoln
Alexandria, US
★★★★★ 4
Easy to put together , decent quality
Color: Black, Size: Wheel-6 Panel
Purchased for office, easy to put together , durable quality , exactly what we needed to partition a small space
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 15, 2025
A
Verified Purchase
Amazon Customer
New York, US
★★★★★ 5
Nice and sturdy
Color: Grey, Size: Wheel-8 Panel
Good privacy wall
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
S
Verified Purchase
Steven J.
Chelsea, US
★★★★★ 1
Super Low Quality/Unacceptable QC
Color: Black, Size: Wheel-6 Panel
I spent probably about an hour putting it together, only to take it right back apart and pack it up to return. The dimples for half the poles were on the wrong side (double and triple checked to make sure they couldn't be spun around. The threaded ends for the wheels were freely spinning on all but 2 wheels, making it impossible to actually tighten them fully. Once it was all put together, the screens could not be folded up to neatly put it aside when not in use. All in all, this was shamefully low quality for the money spent.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 22, 2024
M
Verified Purchase
Miriam Avila Sanchez
Whiting, US
★★★★★ 5
Needed for Sunday School
Color: Grey, Size: Wheel-6 Panel
This was purchase to divide two Sunday school children classes. It works wonderful, big enough, sturdy and with wheels, so is easy to move. Thanks God we can find everything in amazon.com. Delivery was fast and perfect. Thank you .
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 6, 2024
M
Verified Purchase
Melissa P
Port Orchard, US
★★★★★ 3
Not as tall as anticipated
Color: Black, Size: Wheel-6 Panel
Definitely not 6 feet tall, more like 5 1/2. Very sturdy and the fabric is thick. Works well for what we're using it for.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 30, 2025

recommand products