SKU: 42227630612

Human GFRAL Protein, His Tag

Sale price$63.00 Regular price$70.00
Save 10%

Pay in installments of $17.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 3 - Sep 8

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human GFRAL Protein, His TagProduct Specification Species Human Synonyms GFRAL, C6orf144 Accession Q6UXV0 Amino Acid Sequence Protein sequence (Q6UXV0, Ser19 Glu351, with C His Tag)

Product Specification


Species Human
Synonyms GFRAL, C6orf144
Accession Q6UXV0
Amino Acid Sequence

Protein sequence (Q6UXV0, Ser19-Glu351, with C-His Tag) SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Expression System HEK293
Molecular Weight Predicted MW: 39.5 kDa Observed MW: 35-45 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

GFRAL is a receptor primarily expressed in the hindbrain and binds to the hormone GDF15. It plays a key role in metabolic regulation, mediating appetite suppression and body weight control in response to stress, inflammation, or disease. GFRAL activation triggers downstream signaling through the RET coreceptor, influencing energy homeostasis. Its association with GDF15 has made it a potential therapeutic target for obesity and metabolic disorders.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 42227630612

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Donna Foust
Dallas, US
★★★★★ 5
Well made filter
High quality item. Fits perfectly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2026
D
Verified Purchase
DB
Phoenix, US
★★★★★ 5
Much Needed Cabin Air Filter Replacement!
This Cabin air filter replacement is working well. It had been a long time since I replaced my cabin filter, so this was a much needed replacement. It was easy to do, and a much needed replacement. The air quality inside my car is much better. It smells fresh, and light and airy now.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2026
T
TJK
Fort Morgan, US
★★★★★ 5
Best cabin filter I've ever seen
This is the most complex and over-engineered cabin air filter I have ever seen, and I mean that in a good way! The overall shell is a hard plastic, and inside it are two basic parts; the filter (HEPA quality) and the loose fill activated charcoal. The filter media appears to be operating room quality, and if I were to guess, I would say it's like a MERV 14 or greater. The pleats are plentiful, and the spacing of the pleats are perfect, as well as the attachment of the media to the filter frame. The charcoal is a loose style fill, and it fits between the back of the filter media and the filter screen on the very back. This must have 5 times the amount of charcoal compared to the charcoal infused media you can get from many suppliers. The frame fits perfect in my 4runner, and it is hard plastic with good gasket material to further help the effectiveness of the media. All in all, this is an incredibly engineered filter, and if you're the type that wants nothing but the best for your vehicle, you've come to the right place by choosing this one. It is pricey, at $20 for one filter at the time of writing this review, but this is a textbook case of "you get what you pay for." I am going to start only buying these from now on, as they are the best quality and construction filter I have seen, and I highly recommend this filter!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 3, 2025
J
jorban
Charlottesville, US
★★★★★ 4
A Simple, Affordable Cabin Filter That Does the Job
I have a mechanic I really trust, which is no small thing these days. The trade off is that he charges a little more for routine services like oil changes, and those visits always include a full vehicle inspection. To manage the cost, I make a point of handling the easy maintenance items myself so he does not feel the need to replace them with higher priced OEM parts. Cabin air filters fall squarely into that category. It takes me about two minutes to replace one, and doing it myself typically saves around fifty dollars. That was the motivation behind picking up this filter for my Toyota Sienna. Right out of the package it fit perfectly. The size is exact, which is important since cabin filters need a snug frame to work properly. There is a clear airflow direction arrow printed on the side, which is one of the two key things I always look for. Without that, it becomes guesswork and you risk installing the filter backward. With the arrow in place, installation is a quick slide and close operation. Functionally, cabin filters are hard to evaluate in real time. You do not get a dramatic change the moment you swap them out. What I rely on instead is whether they fit correctly, whether they load evenly over time and whether they avoid shedding material as they age. Based on construction and feel, this one meets those expectations. It is pleated well and the frame holds its shape. All signs point to it filtering properly, which is the baseline requirement. Because cabin filters need changing fairly often, it never makes sense to overspend on OEM versions unless you have a specific airflow sensitivity or unique environmental need. This filter costs far less and performs the key functions just as well for general use. In my Southern California environment, where dust and pollen appear regularly, I prefer to replace filters on the more frequent side, which makes the lower cost even more practical. The simplicity of the whole process is what I appreciate most. No tools, no struggle, no surprises. The filter pops in cleanly, the compartment closes and the job is done. When paired with the peace of mind of not paying dealership pricing for such a simple part, it becomes an easy product to recommend. A dependable, properly fitting cabin filter at a very reasonable price. Four stars.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 4, 2025
K
Kevin Barr
Alexandria, US
★★★★★ 5
So premium I can't even test the quality
edit- after about six weeks of driving through various conditions I can say that the air quality this filter produces is excellent., removing all smoggy odor. There is a minor soapy smell that is not offensive, just unusual. So I am very pleased with this item. original review- This really seems like a premium upgrade compared to the budget filters I normally buy. Unfortunately I live in a hot and dry climate (no humidity buildup to cause musty or sour odors and AC always running which dries the air also) and I do not smoke so I never have any odor problems in my vehicle to test the charcoal feature with. I also am not prone to dust allergies so I don't know how helpful the HEPA feature is. If I get stuck in traffic in a smoggy area or behind an especially smoggy vehicle I will switch to fresh air mode to learn if the charcoal feature helps and update this review. There is no paperwork in the box or arrows printed on the filter to determine which way to insert it. I am assuming the airflow path is downward and should pass through the paper side first, so I installed the paper side up.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 9, 2025

recommand products