SKU: 43227985175

VSIG3/IGSF11 Fc Chimera Protein, Human

Sale price$259.20 Regular price$288.00
Save 10%

Pay in installments of $72.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 12 - Sep 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

VSIG3/IGSF11 Fc Chimera Protein, HumanProduct Specification Species Human Antigen VSIG3 IGSF11 Synonyms VSIG3, IgSF11, CXADRL1, Bt IgSF, CT119 Accession Q5DX21 1 Amino Acid Sequence Leu23 Gly241, with C terminal Human IgG1 Fc

Product Specification


Species Human
Antigen VSIG3/IGSF11
Synonyms VSIG3, IgSF11, CXADRL1, Bt-IgSF, CT119
Accession Q5DX21-1
Amino Acid Sequence

Leu23-Gly241, with C-terminal Human IgG1 Fc

LEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIGIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

55-70kDa (Reducing)

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1. Suzu S, Hayashi Y, Harumi T, Nomaguchi K, Yamada M, Hayasawa H, et al. Molecular cloning of a novel immunoglobulin superfamily gene preferentially expressed by brain and testis. Biochem Biophys Res Commun (2002) 296(5):1215–21.

Background

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 43227985175

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
JB
Port Orchard, US
★★★★★ 5
The only sunscreen I can get my dad to wear
Size: 5 Fl Oz (Pack of 1)
I love this sunscreen. I use it when I am too lazy or in a hurry to apply sunscreen from the tube, or when I am reapplying. I also like to use it on my legs because it is so much faster than applying tube sunscreen. This is quite effective and offers almost as much sun protection as my tube physical sunscreens that are SPF 50 with a high zinc oxide content. My dad, who has fair skin and always refuses to wear sunscreen, even though I can see him getting burned - actually agreed to apply this sunscreen because it is not yucky and is actually a pleasant application. He even said he liked using it, so I ordered him a can of this and I think he might start using it on his own! I am so thankful I found something that he is willing to use! There is no white cast at all and does not require rubbing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 30, 2023
R
Verified Purchase
Robert Bolt II
Battle Creek, US
★★★★★ 4
Light spray with pleasant scent
Size: 5 Fl Oz (Pack of 1)
I really like this product. It goes on lightly, it’s not greasy and the smell is nice. Although, I noticed that even with multiple applications I still got a slight sunburn. For this reason, I wouldn’t trust it for a long day out in the sun. It’s better suited for an average day with light to moderate sun exposure.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 25, 2023
J
Verified Purchase
Jhow
Omaha, US
★★★★★ 5
Protects your skin better than other brands due to Helioplex Technology
Size: 5 Fl Oz (Pack of 1)
Had Mohs surgery after they found a spot on my bald head. The office gave me a very short list of things to do to protect my skin going forward. This was on that list because it contains Helioplex Technology. Now if they are going to suggest I use helioplex technology to protect my skin then I am going to start using it, and now. I have been using it all summer. It works well, my skin feels great after using this sunscreen. No greasy feel. The spray is fantastic, no slimy hands from spreading lotion. Best of all it last for a long time on the skin. We should all be wearing sunscreen and this one has the newest technology. Neutrogena for the win!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 21, 2024
T
Verified Purchase
Trista
Chelsea, US
★★★★★ 5
Doesn't smell like sunscreen
Size: 5 Fl Oz (Pack of 1)
This is so easy to apply and it smells great. I am sensitive to the sun but I hate smelling like sunscreen, this has a fresh clean smell and goes on evenly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
E
Verified Purchase
EB
Massapequa, US
★★★★★ 5
my go to spray on
Size: 5 Fl Oz (Pack of 1)
my go to. not too sticky or overwhelming smell.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026

recommand products