Pay in installments of $33.75 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 20 - Sep 25
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Mouse NK1.1, His tagProduct Specification Species Mouse Synonyms Killer cell lectin like receptor subfamily B member 1G, Natural killer cell surface protein NKR P1G, Natural killer lectin like receptor 1E, Gm4696, Klrb1d, Klrb1g, Klrb6, Nkrp1g Accession Q0ZUP1 Amino Acid Sequence Protein sequence (Q0ZUP1, Gln64 Val214, with C 10*His)
Product Specification
| Species | Mouse |
| Synonyms | Killer cell lectin-like receptor subfamily B member 1G, Natural killer cell surface protein NKR-P1G, Natural killer lectin-like receptor 1E, Gm4696, Klrb1d, Klrb1g, Klrb6, Nkrp1g |
| Accession | Q0ZUP1 |
| Amino Acid Sequence | Protein sequence (Q0ZUP1, Gln64-Val214, with C-10*His) QKPLIEKCSVAVQENRTEPTGRSATLECPRDWHPHCDKCLFTSQTSRPWADGLVDCNLKGATLLLIQDEEELRLLQNFSKGKGQQFYIGLKYEEVDKVWKWMNGSILNTNLLQITGKDEENSCALISQTEVFSDSCSSDNHWICQKTLKHVGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 18.9 kDa Observed MW: 20-30 kDa |
| Purity | ＞95% by SDS-PAGE |
| Tag | with C-10*His |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Killer cell lectin-like receptor subfamily B, member 1, also known as KLRB1, NKR-P1A or CD161 (cluster of differentiation 161), is a human gene. Natural killer (NK) cells are lymphocytes that mediate cytotoxicity and secrete cytokines after immune stimulation. Several genes of the C-type lectin superfamily, including the rodent NKRP1 family of glycoproteins, are expressed by NK cells and may be involved in the regulation of NK cell function. The KLRB1 protein contains an extracellular domain with several motifs characteristic of C-type lectins, a transmembrane domain, and a cytoplasmic domain. The KLRB1 protein, NKR-P1A or CD161, is classified as a type II membrane protein because it has an external C terminus. NKR-P1A, the receptor encoded by the KLRB1 gene, recognizes Lectin Like Transcript-1 (LLT1) as a functional ligand.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy