SKU: 44075796855

Human IL-17A, His tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 9 - Sep 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-17A, His tagProduct Specification Species Human Synonyms Cytotoxic T lymphocyte associated antigen 8 (CTLA 8) Accession Q16552 Amino Acid Sequence Protein sequence(Q16552, Gly24 Ala155, with C 10*His) GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 16. 8kDa Actual: 17, 20kDa Purity 95% by SDS PAGE Endotoxin

Product Specification


Species Human
Synonyms Cytotoxic T-lymphocyte-associated antigen 8 (CTLA-8)
Accession Q16552
Amino Acid Sequence

Protein sequence(Q16552, Gly24-Ala155, with C-10*His) GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:16.8kDa Actual:17, 20kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

IL-17A is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 44075796855

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Lp
Natrona Heights, US
★★★★★ 5
Amazing quality for the price! So fresh and lightweight
Color: 03 - Light Grey, Size: Queen
I am very impressed with this queen sheet set! I originally bought it because of the great price, but the quality has exceeded my expectations. The fabric is incredibly soft, lightweight, and stays very fresh throughout the night. It truly gives you that comfortable hotel bedding feel without breaking the bank. If you are looking for breathable and budget-friendly sheets, I highly recommend this set
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
J
Verified Purchase
jeniene
Belleville, US
★★★★★ 4
Utopia bedding is GREAT
Color: 15 - Sage Green, Size: King
I had never heard of Utopia before I suddenly needed to buy bedding for my adult autistic son. He has sensory issues so shopping for anything that touches his body is a bit of a nightmare. I took a gamble on these sheets but it paid off big time! He says they are the most comfortable sheets he has ever slept on and that he doesn't overheat sleeping in them. What I liked about them is that the pockets were deep enough that it fit on his oversized plush mattress easily. I love the color and the ones I bought were very true to the picture. These are soft, comfy, they look nice and they are affordable. I liked this brand so much that I went ahead and got pillows and a comforter from them as well. Its is great for my son and I am very pleased to have found a fabric he tolerates.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
O
Verified Purchase
Oldvtgal
Houston, US
★★★★★ 5
For soft, sensually awesome sheets- LOOK no more!
Color: 15 - Sage Green, Size: Full
Would give 10 stars if possible! (And this is a nonpaid for review!) When I received the sheets, instantly I knew that I had the right ones, had bought a down comforter close in color as well.. these sheets? The material is strong yet, soft and warm. So so especially soft, and when I make up the bed, ahhh! plus the corners on the fitted, such a cinch to pull over the mattress, even with a topper on the bed! Feels almost spa-like <3 Very comfy, so far in the winter and in 85 degree heat! Soft and easy peasy to care for, too. Washing is a breeze, dry and fold. So far the only thing I can smell on these sheets is my wonderful detergent! Will purchase again. And possibly, again! Thank you!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
T
Verified Purchase
Travel in Comfort
Cuba, US
★★★★★ 5
Soft luxury on a modest price
Color: 01 - White, Size: King
These sheets are truly luxurious. They are thin, but feel wonderful against your skin. The sheets are roomy enough to latch onto the corners without having to lift the mattress and stretch. The thread count provides incredible softness against your skin. The pillowcases are roomy enough for your pillow so that you do not have to feel like you’re stuffing sausages.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
J
Verified Purchase
Jennifer
Chelsea, US
★★★★★ 5
Honest Company making things right!
Color: 02 - Antique White, Size: California King, Color: 02 - Antique White, Size: California King
Love how this Californai sheet set feels and they fit very nicely on my bed. They are beautiful although I am unhappy with the 2 small holes I found in the fitted sheet after pulling them out of the packaging. I am past the return as I was not able to use them on my bed because I was moving and my bed was in storage. This is very disappointing for such a beautiful sheet set. UPDATE- I have reached out to the company and they were very kind and helpful. I stated the situation along with pictures and the order # and the company quickly responded with a new fitted sheet. Such a delight to find an honest company wanting to do the right thing. I Will order from this company again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026

recommand products