SKU: 5065049318

Mouse GR-1 (Ly-6G), His tag

Sale price$101.25 Regular price$112.50
Save 10%

Pay in installments of $28.12 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 3 - Sep 8

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse GR-1 (Ly-6G), His tagProduct Specification Species Mouse Synonyms Lymphocyte antigen 6G, Ly 6G. 1 Accession P35461 Amino Acid Sequence Protein sequence (P35461, Leu27 Asn105, with C 10*His) LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 10. 3 kDa Observed MW: 11, 17 19 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical Appearance Lyophilized Powder

Product Specification


Species Mouse
Synonyms Lymphocyte antigen 6G, Ly-6G.1
Accession P35461
Amino Acid Sequence

Protein sequence (P35461, Leu27-Asn105, with C-10*His) LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 10.3 kDa Observed MW: 11, 17-19 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Lymphocyte antigen 6G (Ly6G) is a 21-25 kDa glycosyolphosphatidylinositol-anchored protein that is predominatly expressed in granulocytes in bone marrow. Ly6G is a member of the so called Ly6/uPAR family of GPI-anchored surface proteins. Only encoded in mice, Ly6G shows structural and functional similarities to another Ly6/uPAR family member, CD177, which is expressed specifically on both human and mouse neutrophils. Ly6G is a homolog of the human CD177 protein, which has been shown to interact with cell adhesion molecules, and serves as a bona fide marker for neutrophils in mice. Ly6G contributes to the early engagement of intracellular pathogens by the immune system.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 5065049318

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
ReneeinPNW
Waukegan, US
★★★★★ 5
Good product, but Amazon cheated me.
Size: 1 Count (Pack of 2)
I have dry mouth. The gel works well for me. I use it in my night guard and it keeps my mouth hydrated all night. However, Amazon messed up the order. I only received one tube instead of the 2 I paid for. Really annoying.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 7, 2026
S
Verified Purchase
Sarah
Boise, US
★★★★★ 5
Great product!
Size: 1 count (Pack of 1)
I have a history of radiation to the head and neck due to cancer. I usually use xylimelts for nighttime which are my go-to. And I can't really sleep without them. But because I use the xylimelts every night, I sometimes get sore gums. I bought this as an alternative. It works well but not as great as xylimelts. It keeps the cheeks and gums hydrated but not the tongue. I still woke up and had to have water because my tongue was dried out. It's the best backup to xylimelts I have found for overnight relief so far. Definitely going to buy again. Likely for daytime use and as a backup to xylimelts.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 27, 2023
R
Verified Purchase
Robbie Ray
Dallas, US
★★★★★ 5
Family Counseling
Format: Hardcover
The Book Family Therapy Techniques is an excellent tool for new counselors. The book provides numerous family situations with an array of treatment approaches that a therapist can use to assist families. The various techniques used by the therapist help them improve relationships between parents, siblings, grandparents and children.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2010
C
Verified Purchase
Christina
Pawtucket, US
★★★★★ 5
great book
Format: Hardcover
Another great book on Structural therapy. When Minuchin writes, it feels like he is speaking directly to you. Not many books are both educational and enjoyable, but his are. If you are interested in studying Structural, you want this book.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 6, 2012
R
Verified Purchase
robin Byrd
Alexandria, US
★★★★★ 5
family therapy, 101
Format: Hardcover
every therapist should have this book - as a reference & learning tool - on his/her bookshelf. Minuchin exemplifies good therapy
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 1, 2013

recommand products