Pay in installments of $42.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 17 - Aug 22
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human L-selectin, His tagProduct Specification Species Human Synonyms CD62 antigen like family member L, Leukocyte adhesion molecule 1 (LAM 1), Leukocyte surface antigen Leu 8, Leukocyte endothelial cell adhesion molecule 1 (LECAM1), Lymph node homing receptor, TQ1, gp90 MEL, SELL, LNHR, LYAM1 Accession P14151 Amino Acid Sequence Protein sequence (P14151, Trp39 Val194, with C 10*His)
Product Specification
| Species | Human |
| Synonyms | CD62 antigen-like family member L, Leukocyte adhesion molecule 1 (LAM-1), Leukocyte surface antigen Leu-8, Leukocyte-endothelial cell adhesion molecule 1 (LECAM1), Lymph node homing receptor, TQ1, gp90-MEL, SELL, LNHR, LYAM1 |
| Accession | P14151 |
| Amino Acid Sequence | Protein sequence (P14151, Trp39-Val194, with C-10*His) WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 19.9 kDa Observed MW: 24, 26-33 kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | with C-10*His |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
L-selectin, also known as CD62L, is a cell adhesion molecule found on the cell surface of leukocytes, and the blastocyst. L-selectin belongs to the selectin family of proteins, which recognize sialylated carbohydrate groups containing a Sialyl LewisX (sLeX) determinant. L-selectin plays an important role in both the innate and adaptive immune responses by facilitating leukocyte-endothelial cell adhesion events. L-selectin is also expressed by lymphoid primed hematopoietic stem cells and may participate in the migration of these stem cells to the primary lymphoid organs. L-selectin is expressed on embryonic cells and facilitates the attachment of the blastocyst to the endometrial endothelium during human embryo implantation. It is cleaved by ADAM17. L-selectin expressed on CD4 T lymphocytes has been implicated in mediating adhesion and entry of HIV. Deficiency epithelial expression of L-selectin ligands has been associated with infertility, while increased expression has been implicated in ectopic pregnancies. The adhesive properties of L-selectin have been shown to contribute to cancer progression.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy