SKU: 53196529263

Human CD326 EPCAM, His tag

Sale price$130.50 Regular price$145.00
Save 10%

Pay in installments of $36.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD326 EPCAM, His tagProduct Specification Species Human Synonyms Adenocarcinoma associated antigen, Cell surface glycoprotein Trop 1, Epithelial cell surface antigen, Epithelial glycoprotein (EGP), Epithelial glycoprotein 314 (EGP314; hEGP314), KS 1 4 antigen, KSA, Major gastrointestinal tumor associated protein GA733 2, Tumor associated calcium signal transducer 1, Ep CAM, GA733 2, M1S2, M4S1, MIC18, TACSTD1, TROP1 Accession P16422 Amino Acid Sequence Protein sequence

Product Specification


Species Human
Synonyms Adenocarcinoma-associated antigen, Cell surface glycoprotein Trop-1, Epithelial cell surface antigen, Epithelial glycoprotein (EGP), Epithelial glycoprotein 314 (EGP314; hEGP314), KS 1/4 antigen, KSA, Major gastrointestinal tumor-associated protein GA733-2, Tumor-associated calcium signal transducer 1, Ep-CAM, GA733-2, M1S2, M4S1, MIC18, TACSTD1, TROP1
Accession P16422
Amino Acid Sequence

Protein sequence (P16422, Gln24-Lys265, with C-10*His) QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKGGGGSHHHHHHHHHH

Expression System CHO
Molecular Weight Predicted MW: 29.1 kDa Observed MW: 33 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Epithelial cell adhesion molecule (EpCAM) is a transmembrane glycoprotein mediating Ca2+-independent homotypic cell–cell adhesion in epithelia. EpCAM is also involved in cell signaling, migration, proliferation, and differentiation. Additionally, EpCAM has oncogenic potential via its capacity to upregulate c-myc, e-fabp, and cyclins A & E. Since EpCAM is expressed exclusively in epithelia and epithelial-derived neoplasms, EpCAM can be used as diagnostic marker for various cancers. It appears to play a role in tumorigenesis and metastasis of carcinomas, so it can also act as a potential prognostic marker and as a potential target for immunotherapeutic strategies. EpCAM is often overexpressed in certain carcinomas, including in breast cancer, colon cancer and basal cell carcinoma of the skin. A problem in EpCAM can indirectly cause Lynch syndrome, a genetic disorder that leads to increased risk of cancer. Mutations in EpCAM have also been associated with congenital tufting enteropathy which causes intractable diarrhea in newborn children.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 53196529263

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Donna D.
Alexandria, US
★★★★★ 5
Multipurpose gloves.
Size: Medium (Pack of 100)
These gloves fit perfectly. They do not rip apart. I am a primary care giver for my 94 years old Mom, and babysit my toddler grandchildren. I also use them in the kitchen and house cleaning. These gloves definitely come in handy. I highly recommend these for multipurpose uses.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026
J
Verified Purchase
Jean Paul
Alexandria, US
★★★★★ 5
Simple, reliable, and gets the job done
Size: 200 Count (Pack of 1)
These are exactly what you expect from Bounty—strong, absorbent, and dependable. They hold up well without tearing easily, even when dealing with messier meals. I like that they feel a bit thicker than generic napkins, so you don’t end up using a handful every time. Great for everyday use, whether it’s quick snacks or full meals. The pack size is convenient and lasts a while, which makes it a solid value. Nothing fancy here, just a product that consistently does what it’s supposed to do. If you want quality napkins without surprises, these are a safe pick.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 12, 2026
S
Verified Purchase
SHANA DANIELS GARDNER
Chelsea, US
★★★★★ 5
The Ultimate Multi-Purpose Napkin - Years of Trusted Quality!
Size: 400 Count
I've been using Bounty paper products for years, and these white napkins absolutely live up to the brand's excellent reputation. There's a reason they're my go-to choice for both napkins and paper towels - they truly are "the quicker picker upper" as their slogan says! The 400-count package offers great value, and I appreciate how these napkins maintain their strength even when wet. Their absorbency is unmatched compared to other brands I've tried. They're perfect for everyday meals, but also work well for casual entertaining since they look clean and presentable. What many people don't realize is just how versatile these napkins are! I sometimes even use them to wash dishes when I need something extra absorbent and sturdy. They don't disintegrate like cheaper napkins and can handle tougher cleaning jobs with ease. If you're looking for reliable, multi-purpose paper napkins that actually work, I highly recommend sticking with Bounty. There's a reason they've been my trusted choice for so many years!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026
S
Verified Purchase
Sheri Lynn
Los Angeles, US
★★★★★ 5
Excellent
Size: 400 Count
Bounty Paper Napkins, White, 400 Count, are a reliable and practical choice for both everyday use and special occasions. These napkins are designed with the classic white color that complements any table setting, making them versatile for family dinners, parties, or casual gatherings. The pack of 400 ensures you have plenty on hand, which is especially handy for larger events or frequent use. Bounty is known for its strong and absorbent paper products, and these napkins live up to that reputation. They hold up well against spills and messes without tearing easily, providing a sense of durability that many other napkins lack. Overall, these napkins offer great value for the quantity and quality. Whether you need them for daily meals or entertaining guests, Bounty Paper Napkins provide a dependable and simple solution. They’re easy to store, use, and dispose of, making clean-up effortless. I would recommend them to anyone seeking a straightforward, dependable napkin option that doesn’t compromise on performance.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 18, 2026
S
Verified Purchase
Shoshanna
Bozeman, US
★★★★★ 5
Excellent, highly absorbent, napkins for every meal
Size: 400 Count
These napkins are amazing! They are soft and plushy feeling. The absorption is incredible and they have a nice , comfortable texture for wiping your hands and face when eating. I believe these can also be used as a paper towel when needed because the absorbency is so great. I am very sensitive to scents which I pick up on more than the average person and these napkins do not have a weird smell to them . I think these are great napkins for all to enjoy. The price is very reasonable for the amount I received (400ct) 🤗❤️
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026

recommand products