Pay in installments of $21.25 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 16 - Aug 21
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human Doublecortin, His tagProduct Specification Species Human Synonyms Doublin, Lissencephalin X (Lis X), DCX, DBCN, LISX Accession O43602 Amino Acid Sequence Protein sequence (O43602, Asn269 Ser360, with C 10*His) NECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLYLPLSLDDSDSGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Predicted MW: 11. 4 kDa Observed MW: 16 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical
Product Specification
| Species | Human |
| Synonyms | Doublin, Lissencephalin-X (Lis-X), DCX, DBCN, LISX |
| Accession | O43602 |
| Amino Acid Sequence | Protein sequence (O43602, Asn269-Ser360, with C-10*His) NECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLYLPLSLDDSDSGGGGSHHHHHHHHHH |
| Expression System | E.coli |
| Molecular Weight | Predicted MW: 11.4 kDa Observed MW: 16 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | with C-10*His |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Doublecortin (DCX) is a microtubule-associated protein expressed by neuronal precursor cells and immature neurons in embryonic and adult cortical structures. In vivo and in vitro assays show that Doublecortin stabilizes microtubules and causes bundling. Doublecortin is a basic protein with an iso-electric point of 10 typical of microtubule-binding proteins. Doublecortin is mutated in X-linked lissencephaly and the double cortex syndrome, and the clinical manifestations are sex-linked. In males, X-linked lissencephaly produces a smooth brain due to lack of migration of immature neurons, which normally promote folding of the brain surface. Double cortex syndrome is characterized by abnormal migration of neural tissue during development which results in two bands of misplaced neurons within the subcortical white, generating two cortices, giving the name to the syndrome; this finding generally occurs in females. At least 49 disease-causing mutations in this gene have been discovered.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy