Pay in installments of $64.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 17 - Aug 22
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
IL-15R alpha/CD215 Fc Chimera Protein, HumanProduct Specification Species Human Antigen IL 15R alpha CD215 Synonyms IL 15RA, IL 15R alpha, Interleukin 15 Receptor Subunit Alpha, CD215 Accession Q13261 Amino Acid Sequence Ile31 Thr205, with C terminal Human IgG1 Fc
Product Specification
| Species | Human |
| Antigen | IL-15R alpha/CD215 |
| Synonyms | IL-15RA, IL-15R-alpha, Interleukin-15 Receptor Subunit Alpha, CD215 |
| Accession | Q13261 |
| Amino Acid Sequence | Ile31-Thr205, with C-terminal Human IgG1 Fc ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTTIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Expression System | HEK293 |
| Molecular Weight | 75-80kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | Human Fc Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage |
· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1、Perrier C. et al. (2013) Interleukin-15 receptor α expression in inflammatory bowel disease patients before and after normalization of inflammation with infliximab. Immunology. 138(1): 47-56. |
Background
IL-15Ra chain is expressed by many cell types including monocytes, dendritic cells, natural killer cells, T cells and fibroblasts. Several isoforms of IL-15Ra exist and are generated either by alternative splicing or by proteolytic cleavage. Hence, IL-15Ra can be found as a membrane receptor or as a soluble receptor (sIL-15Ra); and as most isoforms of the receptor contain a sushi domain allowing very-high-affinity binding of IL-15, signaling or regulatory functions can be attributed to the receptor. Competition between soluble and membrane receptors can result in reduced biological activity of IL-15, though a super agonist effect of the soluble form was also observed. The signaling of IL-15 appears more complicated than for other cytokines because IL-15 primarily exists as a complex bound to IL-15Ra. When IL-15/IL-15Ra complexes are shuttled to the cell surface, they can stimulate opposing cells through the b/cC receptor complex (trans-presentation), or alternatively may allow an autocrine stimulation (cis-presentation).
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy