SKU: 56290955557

CD7 Ligand/SECTM1 His Tag Protein, Mouse

Sale price$226.80 Regular price$252.00
Save 10%

Pay in installments of $63.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 27 - Oct 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD7 Ligand/SECTM1 His Tag Protein, MouseProduct Specification Species Mouse Antigen CD7 Ligand Synonyms CD7 Ligand, SECTM1, K12 Accession NP_663348 Amino Acid Sequence Gln28 Thr165, with C terminal 8*His QNKSWDNPICTEGILSVPRGNPAVMTCNISNTFTDVTIQLSANGKDKTIFDKKPQGNFSWRGWELQVQGGLAQLVIKDTQDDHTGIYLWQLHGRQRCYKNITLNILEPSNEDKVPDTTLFTSFPDHAKSSPIEGKPGTGGGSHHHHHHHH Expression System HEK293 Molecular Weight 25 35kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical

Product Specification


Species Mouse
Antigen CD7 Ligand
Synonyms CD7 Ligand, SECTM1, K12
Accession NP_663348
Amino Acid Sequence

Gln28-Thr165, with C-terminal 8*His QNKSWDNPICTEGILSVPRGNPAVMTCNISNTFTDVTIQLSANGKDKTIFDKKPQGNFSWRGWELQVQGGLAQLVIKDTQDDHTGIYLWQLHGRQRCYKNITLNILEPSNEDKVPDTTLFTSFPDHAKSSPIEGKPGTGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 25-35kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Lyman S D. et al. (2000) Identification of CD7 as a cognate of the human K12 (SECTM1) protein. J Biol Chem. 275(5): 3431-3437.

2、Lam G K. et al. (2005) Expression of the CD7 ligand K-12 in human thymic epithelial cells: regulation by IFN-gamma. J Clin Immunol. 25(1): 41-49.

Background

SECTM1 (secreted and transmembrane 1), also called K12, is either found as an approximately 27 kDa intracellular type I transmembrane protein that shows a perinuclear, Golgi‑like staining pattern, or as a 20 kDa soluble, secreted form. SECTM1 is expressed on thymic epithelial and fibroblast cells, breast cancer and leukemia cell lines, and neutrophils but not in peripheral lymphocytes. SECTM1 is expressed on cytomembrane, which is identified as a CD7 ligand.CD7 is expressed in T and natural killer (NK) cells, which could be activated by its ligand SECTM1, thus promoting the proliferation of T and NK cells. SECTM1 strongly costimulates CD4 and CD8 T cell proliferation and induces IFN-γ production, likely via a CD7-dependent mechanism. In addition, SECTM1 synergizes with suboptimal anti-CD28 to strongly augment T cell functions. A robust induction of IL-2 production when SECTM1 and anti-CD28 signals were present with TCR ligation.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 56290955557

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
Y
Y
Lexington, US
★★★★★ 4
It holds the phone pretty well!
Updated review: I gave this another try and it worked, the reason was previously I was rotating the nob in the wrong direction... now it fits pretty well and stays in the installed position securely! But I'm still worried about the added pressure on the display, hopefully it works fine. Overall I think it's worth a try if you need a magnetic phone holder! (ps: I was never contacted by the manufacture, I figured out the correct way to use it so I came here to update my review) --- Original title: Doesn't fit my Model 3 display too well, and it adds pressure on it. I wouldn't recommend it Original review: I don't understand all the positive reviews of this MagSafe holder. It could work, but I find it very unstable on my Model 3 2023's display. After I fit it onto the display and tried adjusting the angles or taking off the phone, the holder tended to fall off. Also it adds pressure to the display which could technically damage it. I wouldn't recommend this.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2024
M
Verified Purchase
Marco mendoza
New York, US
★★★★★ 5
👍👍👍
🥰🥰🥰
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 21, 2025
H
Verified Purchase
helen
Phoenix, US
★★★★★ 1
not holding up well
It was a great idea and kinda worked for few weeks.. but every time I have to jiggle a bit to get my phone off from magnet or try to adjust the angle, the whole system comes off.. and now all the supporting sponges came off.. I tried to fix and reuse but didn't last at all.. it comes off too easily from the car monitor.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 27, 2024
T
Verified Purchase
Tutu the Giant
Lowell, US
★★★★★ 5
So Much Worth It!
This phone holder works so well! It is sturdy and hold on pretty tight. Very easy to put the phone on and off the holder. It even protects the screen so well with the little corner protection foam! Five out of five stars!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 5, 2024
M
Verified Purchase
Misha2219
Bozeman, US
★★★★★ 5
Works on 2025 Ford Escape
Size: Upgrade - For Model Y Juniper/Model Y/Model 3
I have searched, read reviews, ordered other items hoping they would work for my 2025 Ford escape. I attached it to the back of my screen. It works great! Holds my Samsung S25 ultra perfectly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026

recommand products