Pay in installments of $25.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 18 - Sep 23
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human PTH , His tagProduct Specification Species Human Synonyms Parathormone, Parathyrin Accession P01270 Amino Acid Sequence Protein sequence(P01270, Ser32 Gln115, with C 10*His) SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 11. 1kDa Actual: 12kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder
Product Specification
| Species | Human |
| Synonyms | Parathormone, Parathyrin |
| Accession | P01270 |
| Amino Acid Sequence | Protein sequence(P01270, Ser32-Gln115, with C-10*His) SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Theoretical:11.1kDa Actual:12kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage |
12 months from date of receipt, -20 to -70 °C as supplied. 6 months. -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Parathyroid hormone (PTH), also called parathormone or parathyrin, is a peptide hormone secreted by the parathyroid glands that regulates the serum calcium concentration through its effects on bone, kidney, and intestine. PTH influences bone remodeling, which is an ongoing process in which bone tissue is alternately resorbed and rebuilt over time. PTH is secreted in response to low blood serum calcium (Ca2+) levels. PTH indirectly stimulates osteoclast activity within the bone matrix (osteon), in an effort to release more ionic calcium (Ca2+) into the blood to elevate a low serum calcium level. Disorders that yield too little or too much PTH, such as hypoparathyroidism, hyperparathyroidism, and paraneoplastic syndromes can cause bone disease, hypocalcemia, and hypercalcemia.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.0 ★★★★★
Based on 23 reviews
Sort
Product Reviews
★★★★★ 4
Fun moving pet toy, but definitely better for dogs
I don’t have a dog, but I do have a cat that loves chasing and batting around balls. I hoped this moving ball would keep her occupied while my girlfriend and I were working, but unfortunately, she wasn’t especially interested. She chased it briefly and touched it a few times, but this is clearly designed more for dogs than cats.
The ball itself works as advertised. It moves unpredictably, vibrates, and has different modes designed to restart when a pet interacts with it. The outer sleeve feels durable, and for under $14, the overall construction is better than I expected.
My biggest complaint is the charging process. You have to remove the internal ball from the protective cover, unscrew it, deal with the lubricant inside, and then access the charging port. It works, but I wish there were an exterior charging connection that didn’t require taking the toy apart.
My cat’s lack of interest isn’t really the product’s fault, so I’m only deducting one star for the awkward charging design. For a dog that loves balls, chasing, or fetch, this could be a fun and inexpensive way to provide extra activity and stimulation.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 10, 2026
★★★★★ 1
Unfortunately another toy...
That doesn't stand up to the kind of dogs that need an interactive toy the most. Dog toy companies are missing the mark. Dogs that need the most entertainment are like our rescue boy in the video. Super smart, active, super chewers. They are the dogs that are abandoned, abused, and put to sleep the most. Why because they can destroy anything when board. The video and pictures say it all. I truly wish I could give less than a star. Value for the money 🤣😮💨😢
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 13, 2026
★★★★★ 2
My dogs loved it, but it doesn't hold up.
My dogs absolutely love this ball! The moment I took it out of the package, they were already trying to play with it.
The vibration is strong, and on hardwood floors it moves around fairly well. It keeps the dogs interested and does a good job of rolling around.
The blue outer ring is made of a mildly tacky, hard rubber. Within about 30 seconds of rolling around, it had already picked up pet hair and lint from the floor. That said, the rubber feels fairly durable. I have some heavy chewers, so I'll update my review later to let everyone know how well it holds up over time.
The charging process is a little unusual and somewhat concerning. To charge the ball, you have to remove it from the rubber shell, unscrew it, and pull out the motor assembly. While doing this, I got some kind of grease on my hand, so I would recommend being careful not to fully remove the motor when charging. It does use a USB-C charging port, and a small charging cable is included.
Overall, my dogs are having a great time with it so far. I'll update this review if anything changes or if the ball doesn't hold up long-term.
UPDATE: It is 2 days later, the rubber net around the ball has lost a lot of it's rigidity and no longer holds the inner ball in place. My dogs are able to easily remove the inner ball, which is hard and small enough for them to swallow. This toy has been taken away as much as they have loved it, as it's now a choking hazard. As a result, my rating has gone from 4 stars to 2.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2026
★★★★★ 5
Highly Entertaining Toy That Keeps Dogs Thrilled, But Smart Pups Can Disassemble It
This interactive ball is an absolute hit with my dogs, and watching them play with it has been incredibly entertaining. Right out of the box, the internal mechanism charged up very fast, so we were able to start a play session almost immediately. It blinks blue when charging and solid green when charged. The unpredictable moving and bouncing motions caught my dogs' attention right away, and they love chasing it around the room. My only critique is that it didn't take them very long to figure out how to pop the inner motorized ball completely out of the outer cage. Luckily, the materials are genuinely durable; even though they separated the pieces, they haven't destroyed or damaged either part yet. It's great fun to watch, but you'll definitely want to keep an eye on smart pups who figure out how to open it up.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2026
★★★★★ 5
Really cool cat toy for even the most picky cat!
Color: A1-Red, Color: A1-Red
I love it, wow. Our cat is picky with toys, but even he was intrigued by it. It really kept his attention, which is hard to do. It comes with three modes: fast, slow, and interactive. The only thing is that hair can get all trapped up in it because it's a wheel, so keep your house clean I guess lol. The tail also came off once, so you gotta snuggly get it on up there. Really cool cat toy though, I'm happy I got it lol
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 23, 2026