Pay in installments of $77.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 8 - Sep 13
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
CEACAM-3/CD66d Fc Chimera Protein, HumanProduct Specification Species Human Synonyms CEACAM3, CD66d, CEA, carcinoembryonic antigen related cell adhesion molecule 3, CGM1, W264, W282 Accession P40198 Amino Acid Sequence Lys35 Gly155, with C terminal Human IgG1 Fc
Product Specification
| Species | Human |
| Synonyms | CEACAM3, CD66d, CEA, carcinoembryonic antigen-related cell adhesion molecule 3, CGM1, W264, W282 |
| Accession | P40198 |
| Amino Acid Sequence | Lys35-Gly155, with C-terminal Human IgG1 Fc KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAGIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Expression System | HEK293 |
| Molecular Weight | 45-50kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | Human Fc Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Schmitter T. et al. (2007) The Granulocyte Receptor Carcinoembryonic Antigen-Related Cell Adhesion Molecule 3 (CEACAM3) Directly Associates with Vav to Promote Phagocytosis of Human Pathogens. The journal of immunology. 178: 3797-3805. 2、Swanson K V. et al. (2001) CEACAM is not necessary for Neisseria gonorrhoeae to adhere to and invade female genital epithelial cells. Cellular Microbiology. 3(10): 681-691. 3、Hasselbalch H C. et al. (2011) High expression of carcinoembryonic antigen-related cell adhesion molecule (CEACAM) 6 and 8 in primary myelofibrosis. Leukemia Research. |
Background
Carcinoembryonic Antigen-related Cell Adhesion Molecule 3 (CEACAM-3), or CD66d, is part of the CEA protein family consisting of CEACAMs and the pregnancy-specific glycoproteins (PSGs). Both CEACAM and PSG molecules have been identified in humans and belong to the much larger glycosylphosphatidylinositol (GPI)-linked immunoglobulin (Ig) superfamily. Human CEACAM-3 is ~35 kDa, consisting of an extracellular domain (ECD) containing one IgV-like domain, a single transmembrane domain and a cytoplasmic tail. CEACAM family members are widely expressed in epithelial, endothelial, and hematopoietic cells, including neutrophils, T-cells, and NK cells. CEACAMs appear to be capable of transmitting signals that result in a variety of effects depending on the tissue, including tumor suppression, tumor promotion, angiogenesis, neutrophil activation, lymphocyte activation, regulation of the cell cycle, and regulation of adhesion. CEACAMs have now been associated with numerous intracellular signaling processes including cell adhesion, cell growth, recognition and differentiation, angiogenesis, and apoptosis. CD66d antibody increases neutrophil adhesion to the monolayer of human umbilical vein endothelial cells.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy