SKU: 59404761116

Cystatin-C His Tag, Human

Sale price$112.50 Regular price$125.00
Save 10%

Pay in installments of $31.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 11 - Sep 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Cystatin-C His Tag, HumanProduct Specification Species Human Synonyms Cystatin CCystatin CCystatin 3CST3 Accession P01034 Amino Acid Sequence Ser27 Ala146, with N 6*His MHHHHHHDDDDKSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA Expression System E. coli Molecular Weight 14. 9 kDa(Reducing) Purity 95% by SDS PAGE Endotoxin <2EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder

Product Specification


Species Human
Synonyms Cystatin-C,Cystatin C,Cystatin-3,CST3
Accession P01034
Amino Acid Sequence

Ser27-Ala146, with N-6*His MHHHHHHDDDDKSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Expression System E.coli
Molecular Weight 14.9 kDa(Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <2EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 100mM NaCl, pH8.0
Reconstitution Reconstitute at 0.1-1mg/mL according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Human cystatin C (hCC) belongs to a family of proteins called cystatins. There are three distinct types of cystatins that share sequence and structure homology but differ in size, site of action, and disulfide bond topology. Human cystatin C belongs to the type 2 cystatins that are generally secreted as extracellular polypeptides. hCC is broadly distributed and found in most body fluids. This small protein consists of 120 amino acids forming a single polypeptide chain. Cystatin C contains four conserved cysteine residues that can form two disulfide bonds but, unlike other family members, was neither shown to be glycosylated (cystatin E/M and cystatin F) nor phosphorylated (chicken cystatin). Furthermore, hCC can be found in monomer, dimer, oligomer, and fibril states.

In terms of biological function, hCC is a target of proteolysis, and primarily functions as a protease inhibitor. It is degraded by cathepsin D and elastase.Uncontrolled proteolysis leads to an imbalance between active proteases and endogenous inhibitors,eventually leading to disease.The hCC concentration in blood correlates with the glomerular filtration rate(GFR), an important marker of kidney health and the progression of diabetes, chronic kidney disease.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 59404761116

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
South Florida Wanderer
Fort Morgan, US
★★★★★ 5
Sunshade
Just installed the new top so far so good.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 24, 2025
W
Verified Purchase
Whitney
Dallas, US
★★★★★ 1
Needs to be Re-designed
I will update this rating depending on the outcome of my customer service/support experience. At this time, I cannot recommend this product. Although it’s marketed for ATV use, it does not withstand the realities that come with ATV riding. The snaps on the straps securing the front of the shade come undone with nearly every bump, making the shade unstable and frustrating to use. On our second trip out with it after about 3 hours of riding, the shade collapsed on me entirely. Initially, I thought the rear hooks had come loose, but to my surprise, the roof frame itself had snapped in half on both sides. I’m still unsure how this even happens. The metal completely snapped right where the roof poles bend in a U. Very odd. It forced us to remove the shade completely and carry it on the back of the quad for the rest of the ride since it was not functional anymore. Given this is only the second time we had even used it I would not recommend anyone purchase this product which is so unfortunate as living in AZ I had very high hopes for this product, as the concept is excellent, but it needs significant reinforcement to handle the rough terrain and constant movement involved in off-road riding and at this time I requesting a full refund and until this company revisits the design to make it sturdier and more reliable I will not consider purchasing again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 1, 2025
J
Verified Purchase
John
Carnegie, US
★★★★★ 4
It’s much more rigid than you might think.
The brackets did not fit the range of diameters that it said it would. Is pretty doofus when you lay it down backwards. It is however, more rigid than you might think. It works for me. I like it. Of course I can change things. I like the exterior fabric and I like the vinyl undercoating. I suspect it’s going to be waterproof as well. Now that I know, I’m not going to lay it down. I’m going to order a second one for my wifes quad, which is even narrower than the minimum they call out. 39.4”.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 2, 2024
A
Verified Purchase
Amazon Customer
Fort Morgan, US
★★★★★ 5
Great customer service
Stong headwind caused front straps to pop off and broke/bent frame. They replaced frame tubes with no hassle! Very impressed!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 22, 2024
S
S.
Bozeman, US
★★★★★ 5
As shown
Nice kit. Simple to assemble, simply packed, good weight for the metal and the shade cloth. Actual width between attachment points is 44 inches. Tubing goes together with those push button things like on aluminum table legs. Priced commensurate with quality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 17, 2024

recommand products