SKU: 63167193307

Human CD36, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 18 - Sep 23

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD36, His tagProduct Specification Species Human Synonyms Glycoprotein IIIb, PAS IV, PAS 4, Platelet glycoprotein IV Accession A4D1B1 Amino Acid Sequence Protein sequence(A4D1B1, Gln35 Asn439, with C 10*His)

Product Specification


Species Human
Synonyms Glycoprotein IIIb, PAS IV, PAS-4, Platelet glycoprotein IV
Accession A4D1B1
Amino Acid Sequence

Protein sequence(A4D1B1, Gln35-Asn439, with C-10*His)
QKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:47.7kDa Actual:70-95kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The CD36 antigen is an integral membrane protein found on the surface of many cell types in vertebrate animals. It imports fatty acids inside cells and is a member of the class B scavenger receptor family of cell surface proteins. CD36 binds many ligands including collagen, thrombospondin, erythrocytes parasitized with Plasmodium falciparum, oxidized low density lipoprotein, native lipoproteins, oxidized phospholipids, and long-chain fatty acids. The protein itself belongs to the class B scavenger receptor family which includes receptors for selective cholesteryl ester uptake, scavenger receptor class B type I (SR-BI) and lysosomal integral membrane protein II (LIMP-II).CD36 has also been implicated in hemostasis, thrombosis, malaria, inflammation, lipid metabolism and atherogenesis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 63167193307

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Julia
Cuba, US
★★★★★ 5
Outstanding Indie Fantasy! You NEED to read this!
I have started and deleted my intro to my review multiple times at this point. My mind is sufficiently BLOWN. This book has landed itself into my top favorite romantasies right alongside ACOTAR and FBAA. ITS SO DANG GOOD. I literally woke up, popped it open on my kindle app (Thanks author and R&R Book Tours for the arc!) and got to reading and just didn’t stop. I couldn’t stop. From the first dang page, Menard dragged my butt in and tied me down. I. Was. HOOKED. Writing Style: I absolutely love the writer’s style! Told from mainly Milla’s POV, with the occasional glance into Nico’s POV when its important. Her world building is rich and immersive, sticking firmly into the steampunk/gas lamp fantasy atmosphere. Her magic system—while feeling familiar—still feels unique and blends beautifully with the world she’s created. Characters: I can’t begin to describe how much I love the characters Menard has created for this story. Milla is a firestorm. She’s passionate, fiesty, loyal, and self confident. She doesn’t back down, no matter the odds. For me, personally, she’s ranking right up there with Feyre (ACOTAR), Poppy (FBAA), and Sera (FBAA prequel) as one of my favorite female leads. Despite her fierceness, she’s not invincible and she’s still vulnerable—which unveils itself more as the story goes on. Nico, mmmmmmmm, Nico. He’s cocky, and strong. His heart is for his blood and family. There’s nothing he won’t do for those he cares for. He’s incredibly insightful which leads to a lot of me squeeing and highlighting his quotes. Pairing him up with Milla is a riot I will watch again and again. The side characters are all phenomenal, ranging wide in personalities and giving the world a richer vibrancy. They compliment both main characters, bringing out the best and worst in them, helping to bring secrets to light and keep the plot going. Not a single character felt out of place, or ever out of character. Relationship: Y’all know I love a good slow burn and this burns so good. The push and pull of their hate/love relationship is a thrill to witness. Watching them fall for each other is a joy and the spice (when we get there) is HAWT. Plot: This story had me hooked, and that’s largely in thanks to how well planned out the story’s plot is. Menard did an excellent job, masterfully balancing her foreshadowing and reveals. While I halfway guessed the big reveal, i definitely did not expect the big reveal. (Read the book, then you’ll understand lmao). The pacing is fantastic. Nothing about the story felt rushed, not the relationship, not the reveals, not the over arching plot line. Just absolutely phenomenal. Enjoyment: 100/10 will read again. I need a physical copy in my life. I HIGHLY recommend this book.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 28, 2023
D
Verified Purchase
Darcie Reads A Lot
Dallas, US
★★★★★ 5
Unexpectedly emotional and packed with action!
Format: Kindle
Why do I suddenly want nothing more than a tiny wyvern to snuggle with?! It’s adorable and I absolutely love all of those moments! Wings of Stars was everything I’ve come expect from this powerful author duo. The fact that it’s written by two different people is completely transparent to the reader and they’ve brought us another world and characters that we’re all emotionally connected to and fully invested in! The injustice that we see from Alfemir in the many forms in which it comes is infuriating and makes me desperate for the conclusion of the story so they can all get what’s coming to them! I love all the guys right now, with one exception, and if you’re read it, you know exactly who I’m talking about. Bastian is hilarious - he was the comedic relief through an otherwise quite serious story. My heart bleeds for him and I can’t wait to see how he progresses through the series. Parts of Wings of Stars were unexpectedly emotional and of course I was left with my jaw on the floor at that cliffhanger! Next, please!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 18, 2025
J
Verified Purchase
josh portwood
Bozeman, US
★★★★★ 5
Niz !!!
Format: Kindle
First, let me say that I love both of these authors. I have been hooked by both ever since I discovered their writings, and I follow their social media groups closely. This book did not disappoint. Sure, there are several questions that I have, a couple of times I went huh (which I won't get into because I do not want to offer any spoilers) and I hated the cliff hanger lol, but I cannot lie and say I didn't love the book, because I did. The twist on angels was new and fresh, even though that is part of my questions. The beginning and ending were the better parts, the middle was needed but sorta bogged a little. Kieran was confusing but relatable. Niz is BY FAR the best character of the book, love NIZ. For me, Bastian is a close second, always loved the crazy ones. The other men were good, but Steele gets on my nerves and as of right now, IMO, he doesn't belong, but we will see how that goes. I have lots of questions, but this was an excellent start to a new series and I cannot wait for the next book. Highly recommend
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 21, 2024
S
Verified Purchase
shark
Phoenix, US
★★★★★ 4
fallen destiny? more like destined to fall in love
Format: Kindle
Kieran is an angel, but she doesn't have an affinity. Nothing angers her father more. If she doesn't find an affinity soon she will be cast to earth & have her wings removed. But she has the choice to become a fallen angel, wings turn black, & live her life on edge. Towards the end of the book things start to make sense. Gabe’s nickname for Kieran, Steele’a hatred, Bastian’s belief that Kieran is powerful. This book ended literally during a war? As one of her friends was injured, and admitted a bit secret? Talk about cliff hanger. The next book comes out August 5th.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 8, 2024
C
Verified Purchase
Caylee T.
Port Orchard, US
★★★★★ 5
Well holy moly!
Format: Kindle
Holy moly that story definitely had me hooked! Kieran was definitely a character that I immediately adored. She has obviously had to deal with a butt load of too high expectations from her father (who is 🤬).. She has been helpless when it came to finding out her affinity with so many years of no answers & perceived failure. When Ronan, gives her a small inkling of hope that she be a Beast Tamer, she jumps into it. But again she doesn’t seem to fit. But when she runs into Gabe again, she ends up helping him & rethinking her life in Alfemir. And when the opportunity comes she decides leaving is the best option. But when Ronan demands he comes with her & then the random appearance of Bastian, she is feeling very overwhelmed. After she chooses to fall with them, they land on earth exactly where Gabe is located only to run into Steele who is a person that I was finding hard to like. After training, she eventually finds out she does have an affinity & it’s one that no longer exist & is incredibly powerful but also has a prophecy attached to it. I feel incredibly bad for her on she learns about the prophecy & Steele’s connection with it too. But that ending, with the battle scene & Niz….yeah definitely was not expecting that but hello I am all here for it too! Absolutely amazing start of a series & I for sure will be waiting for the next one to come out. Amazing job!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 26, 2024

recommand products