SKU: 64237993697

Human MCM6, His tag

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 19 - Sep 24

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human MCM6, His tagProduct Specification Species Human Synonyms p105MCM Accession Q14566 Amino Acid Sequence Protein sequence (Q14566, Val676 Asp821, with C 10*His) VDEGAGGINGHADSPAPVNGINGYNEDINQESAPKASLRLGFSEYCRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLEDGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 18. 2 kDa Observed MW: 24 kDa Purity 95% by SDS PAGE Tag with C 10*His Physical Appearance

Product Specification


Species Human
Synonyms p105MCM
Accession Q14566
Amino Acid Sequence

Protein sequence (Q14566, Val676-Asp821, with C-10*His) VDEGAGGINGHADSPAPVNGINGYNEDINQESAPKASLRLGFSEYCRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLEDGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 18.2 kDa Observed MW: 24 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

DNA replication licensing factor MCM6 is a protein that in humans is encoded by the MCM6 gene. MCM6 is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The MCM complex consisting of MCM6 (this protein) and MCM2, 4 and 7 possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre-RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The phosphorylation of the complex by CDC2 kinase reduces the helicase activity, suggesting a role in the regulation of DNA replication. Mcm 6 has recently been shown to interact strongly Cdt1 at defined residues, by mutating these target residues Wei et al. observed lack of Cdt1 recruitment of Mcm2-7 to the pre-RC.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 64237993697

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
I
Verified Purchase
Iuliia
Omaha, US
★★★★★ 5
Good deal
Scent: North Bondi, Size: 1.7 Fl Oz (Pack of 1)
Good quality for the price. Smell of clean sheets (that is not a very safe blind buy considering that smells of cleanness are very particular), also has a strong note of violet flowers, consider it while buying. It is also pretty long-lasting for these types of perfumes. Overall, I’m happy with a purchase and a scent, what surprised me the most is the magnetic cap.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 23, 2026
W
Verified Purchase
WhatTheJNell
Phoenix, US
★★★★★ 5
Amazing scent!
Scent: North Bondi, Size: 1.7 Fl Oz (Pack of 1)
AMAZING smell, and it lasts so long too! I did one spray and could smell it for the rest of the day. The perfect scent for someone who doesn’t like overpowering, but also wants a clean scent. I am OBSESSED.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2026
L
Verified Purchase
Lisa Versa
Pawtucket, US
★★★★★ 5
Nice and fresh
Scent: North Bondi, Size: 1.7 Fl Oz (Pack of 1)
Smells great! Initial smell is more fresh cucumber than the leave-in hair product than I'd like but it wears off fast enough and dries down nice.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 3, 2026
M
Verified Purchase
Mookie
Grantham, US
★★★★★ 1
The North Bondi is nasty waste of money.
Scent: North Bondi, Size: 0.34 Fl Oz (Pack of 1), Scent: North Bondi, Size: 0.34 Fl Oz (Pack of 1)
I thought it smelled fresh or clean, but it smells like bad breath, and sun cream. At first it smells floral but then fades. I don’t like it so all.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 5, 2025
P
Verified Purchase
Patricia
Alexandria, US
★★★★★ 5
Very beautiful scent. Glad I bought it
Scent: North Bondi, Size: 1.7 Fl Oz (Pack of 1)
Love the scent. Definitely worth the money
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2026

recommand products