Pay in installments of $70.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 12 - Sep 17
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
EphA3 His Tag Protein, HumanProduct Specification Species Human Antigen EphA3 Synonyms BCM1, EK4, ETK, ETK1, HEK, HEK4 Accession P29320 1 Amino Acid Sequence Glu21 Gln541, with C terminal 10*His Tag
Product Specification
| Species | Human |
| Antigen | EphA3 |
| Synonyms | BCM1, EK4, ETK, ETK1, HEK, HEK4 |
| Accession | P29320-1 |
| Amino Acid Sequence | Glu21-Gln541, with C-terminal 10*His Tag ELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEHYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETFNLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFYLAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDGSMNCRCENNYFRADKDPPSMACTRPPSSPRNVISNINETSVILDWSWPLDTGGRKDVTFNIICKKCGWNIKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSSPPRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQETSYTILRARGTNVTISSLKPDTIYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGESSQGGGSGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 65-75kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1. Marwah M. Al-Mathkour, Abdulrahman M. Dwead, Esma Alp, Ava M. Boston, and Bekir Cinarcorresponding author. The Hippo effector YAP1/TEAD1 regulates EPHA3 expression to control cell contact and motility. Sci Rep. 2022; 12: 3840.Published online 2022 Mar 9. |
Background
Ephrin type-A receptor 3 (EPHA3), a member of the EphA receptor subclass, controls cell fate, cell shape, cell communication, axon guidance, and the embryonic development of vital organs like the brain, heart, lungs, and kidney. For example, EPHA3 signaling mediates elongation and navigation of axons and trajectories and the assembly of spinal motor neuron axons. In addition, a recent study has suggested that EPHA3/ephrin-A5 signaling limits axon development and governs axon guidance in developing neurons. Also, EPHA3 could modulate cell migration and neurite outgrowth, likely by controlling actin dynamics through CrkII and RhoA signaling. Moreover, increasing evidence suggests that dysregulated EPHA3 signaling is implicated in multiple malignancies with poorer prognosis. Despite these observations, however, little is known about the mechanism contributing to the transcriptional regulation of EPHA3.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy