SKU: 65654209826

CD7 Ligand/SECTM1 Fc Chimera Protein, Human

Sale price$226.80 Regular price$252.00
Save 10%

Pay in installments of $63.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 23 - Sep 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD7 Ligand/SECTM1 Fc Chimera Protein, HumanProduct Specification Species Human Antigen CD7 Ligand Synonyms CD7 Ligand, SECTM1, K12 Accession Q8WVN6 Amino Acid Sequence Gln29 Gly145, with C terminal Human IgG1 Fc

Product Specification


Species Human
Antigen CD7 Ligand
Synonyms CD7 Ligand, SECTM1, K12
Accession Q8WVN6
Amino Acid Sequence

Gln29-Gly145, with C-terminal Human IgG1 Fc QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 44-49kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Lyman S D. et al. (2000) Identification of CD7 as a cognate of the human K12 (SECTM1) protein. J Biol Chem. 275(5): 3431-3437.

2、Lam G K. et al. (2005) Expression of the CD7 ligand K-12 in human thymic epithelial cells: regulation by IFN-gamma. J Clin Immunol. 25(1): 41-49.

Background

SECTM1 (secreted and transmembrane 1), also called K12, is either found as an approximately 27 kDa intracellular type I transmembrane protein that shows a perinuclear, Golgi like staining pattern, or as a 20 kDa soluble, secreted form. SECTM1 is expressed on thymic epithelial and fibroblast cells, breast cancer and leukemia cell lines, and neutrophils but not in peripheral lymphocytes. SECTM1 is expressed on cytomembrane, which is identified as a CD7 ligand.CD7 is expressed in T and natural killer (NK) cells, which could be activated by its ligand SECTM1, thus promoting the proliferation of T and NK cells. SECTM1 strongly costimulates CD4 and CD8 T cell proliferation and induces IFN-γ production, likely via a CD7-dependent mechanism. In addition, SECTM1 synergizes with suboptimal anti-CD28 to strongly augment T cell functions. A robust induction of IL-2 production when SECTM1 and anti-CD28 signals were present with TCR ligation.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 65654209826

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jenniraereads
Bozeman, US
★★★★★ 5
Outstanding book - A MUST READ
This is fantasy romance at its finest, and I couldn’t put it down from the moment I started. Packed with classic romantasy tropes that are done so well, especially my favorite: fated mates! The world-building is both easy to digest and detailed enough to feel immersive. It strikes the perfect balance—not too vague but never overwhelming. The world is divided between several groups of people, and the story revolves around the Alaha, who live on the water, and the Kenta, who reside on land. For centuries, these two factions have maintained a fragile peace, but things take a sharp turn when our FMC, Brynn, threatens that peace right at the beginning of the book. What follows is a thrilling dive into a world of magic, rebellion, and secrets. I will say no more, because you should go into this book relatively blind to get the full experience. Brynn, our FMC, is everything you could want in a lead. She’s smart, confident, and refuses to bow to threats. Then there’s the MMC, Acker. Scrumptious doesn’t even begin to cover it. The chemistry between him and Brynn is electric, and their dynamic had me grinning (and swooning) throughout. This book has all the best romantasy tropes: forced proximity, slowest of slow burns, elemental magic, fated mates (done right), political intrigue, and plot twists you will not see coming! Each trope is executed masterfully, blending seamlessly into the story without feeling overdone. If these are your jam, you’ll absolutely love this book. Even if they are not usually your cup of tea, this book may change your mind. While the pacing is fast and gripping overall, it does have a bit of a lull in the middle. That said, the ending more than made up for it—it left me gasping and desperate for the next book. I think I said aloud, “What the hell just happened?” when I finished the last page. This book grabbed me by the neck and didn’t let go. It’s full of banter, twisty turns, and a delicious tension. Probably one of my favorite fantasy reads this year. I am going to be thinking about this book non-stop until book 2 is released!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 30, 2024
N
Verified Purchase
Nicole Gassman
New York, US
★★★★★ 4
Cool world building and great side characters
Format: Kindle
I adored the side characters and found them a lot more compelling than Jovie and Acker, if I’m being honest. I really wanted to like her but I found myself getting frustrated by her lack of, I don’t know, real rage for any of the crap people pull on her. Like ok I get this is romantasy but I have a hard time really believing you’re actually as upset at this guy as you claim to be when two minutes later you’re letting this dude shove his tongue down your throat. Additionally, an early running theme is that Jovie is frustrated that there are a bunch of people deciding things for her but the existence of the whole “matched/bond” thing makes much of her autonomy a moot point. Like at one point I think Acker even points out that them getting into bed together is a “foregone conclusion” and someone else mentions that the other matched pairs that don’t end up together ended up literally destroying each other. No pressure. I was a lot more interested in the characterization of Messer, Beau, and Hallis. I knew I was going to be exasperated consistently by this girl when she let Mr. Murder Hottie treat Messer like a war criminal after he almost got himself spatchcocked for them by a mighty-morphing radical with an attitude problem. If my homie went through the battle blender like that for me after I found out he had been secretly protecting me and keeping me company for weeks/months, I would be doing A LOT MORE than standing around trying to figure out if I actually thought he was my friend while Captain Boy Toy did some light torture on him. Also Acker, my dude, if you can still find it in your heart and your loins to get riled up while your sister is having a breakdown in the room over…I don’t know, seek help I guess. I liked the juxtaposition of Beau’s bravado and her militaristic delivery of information to her brother showing she can turn on a dime when needed. Adding the mental toll her gift takes on her throughout time and how she has self destructive coping mechanisms really gave her some cool depth, and I appreciated the vulnerability it lent her. Hallis was a weird character for me at first but I ended up looking forward to his dialogue a lot. Initially, I didn’t care for the way he seemed to immediately just be a real jerk to Jovie and it didn’t often read as playful to me when I think it sometimes meant to. Regardless, his genuine care for Beau and Acker and how he dropped the act immediately when they really needed him made him pretty endearing and I always appreciate a grump who cares. Honestly everything about this book was an A+ for me aside from the two main characters’ dynamic. When Jovie gets pissed at those bats and obliterates a forest? A+ When she tells Acker that she saw the signs that Messer was getting abused and acknowledged she felt shame and that she couldn’t fault him for being complicit in her mistreatment since she had done the same? A+ When she’s sitting there and coming to terms with the fact that everything she knows has been built on lies as she’s flipping through her sketchbook? A++ The writing and setting is great and the book is good, but someone needs to give Jovie a big stick and tell her it’s okay to be mad and smack people with it even if they’re hot.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 19, 2025
D
Verified Purchase
Dimps
Lake Worth, US
★★★★★ 5
Mind blowing page turner
Oh my stars!!! 🤯 he falls first and he falls hard, enemies to lovers, fated mates. Every characters are lovable. There's action, magic, one horse 🤭 and a plot twist that keep on twisting. Oh and a bad ass FMC! Loved it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
B
Verified Purchase
Bryan & Lanae Kirby
San Leandro, US
★★★★★ 3
Interesting. Confusing ending that's too similar to another book
Ok, I had to process almost a whole 24 hours before I could write this review. And long story short, did I enjoy the book, yes. Does it have a lot of interesting and good parts to it? Also yes. But does it also have some major flaws? Absolutely. Now I'm not gonna break down every single little thing in this book. But here are the basics of what I liked, and what I didn't like. The good? I liked the characters. They intrigued me off the bad. The world building is pretty decent. It's a little confusing in the beginning, but information is slowly doled out, and some questions are answered. I found that there was a lot of little twists and turns that kept the story engaging. The magic system is intriguing. But, there are quite a few things off for me. First off, we have another story that has heavy inspirations from other books. There are a lot of aspects in this story that felt directly pulled from throne of glass. And the big twist at the end? Was almost verbatim the same ending as the book how does it feel. As soon as I read it I was like hold up, I literally just read almost this same thing when I read how does it feel when it released like a year or year and a half ago. Now I know no concepts are really new anymore, and inspiration comes for everywhere. But I feel like most stories it's like, oh this book has these vibes, or if you liked this book you'd like this one that's similar. But this reminds me of powerless in where there are like exact plots and plot points taken from other things. Now is that a bad thing? Not necessarily. I still enjoyed powerless, and I still enjoyed this story. But it does throw me. There are also a few red flags that the MMC Acker gave me that were not the good kind of red flags we love. First, when they are riding thru the city and people throw stuff at the FMC and he does nothing? Red flag. When they meet his dad and they demand she vows not only to the king but to the MMC? Red flag. All the secrets he keeps? Red flag. When he SLAPS HER IN THE END? Red flag. I'm not sure how I really feel about him. In the end. This was still an enjoyable read. I did like it and I am curious about the next book. But I am wary about some of the plot points and the MMC.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 26, 2024
E
Verified Purchase
evelynn kate
Lake Worth, US
★★★★★ 5
AMAZING debut novel!!!
Format: Kindle
Plot ⭐️⭐️⭐️⭐️ Spice 🌶️🌶️.5 Romance 💘💘💘 Vibes ⭐️⭐️⭐️⭐️⭐️ Dual 1st person POV - Ara (26) & Rogue (39 - but looks mid-20s: they can live hundreds of years so this isn't that large of a gap as it could've been which I heavily appreciate lol) Tropes: enemies to lovers, fae/human wars (deep hatred for each other), shifters (dragons- MMC can only partial shift with wings), one horse, one bed, touch her and d!e, found family, abduction turned to freedom The Last Storm is the debut novel from JD Linton and let me tell you, you guys NEED to read this. The plot was engaging and the editing was was amazing (especially for a debut novel). Our FMC, Ara, is stuck in her gilded cage longing for a life outside of her small town. She uses her books to escape and live vicariously through the pages (honestly, relatable). After her father announces her betrothal to her childhood friend (to whom she has no romantic feelings for), Ara tumbles unknowingly into a desperate plot trying to stop the humans from slaughtering the Fae. As one can expect from an enemies to lovers / kidnapper/captive romance, Ara fights her attraction and lust towards our MMC, Rogue (the King of the Fae), for as long as she can. Upon seeing Ara for the first time, Rogue is instantly aware that she is his fated mate (not a spoiler). Since she is the General's only daughter, he plans to abduct her and use her as leverage to stop the brutality. During Ara's time in Rogue's captivity, their banter and chemistry continue to rise until they finally boil over and come together (quite literally, and many times I may add 😉). Here's what I LOVED: - Rogue continuously seeks advice from his elders and deeply respects their opinions and life experience and tries to implement their recommendations - Rogue makes many mistakes in the beginning but we see him actively work on not repeating them as the book progresses. The level of self-awareness and his ability to change his behavior was impressive - The magic system is intricate and we have only scraped the surface. As the series continues and Ara progresses in her powers, I'm sure we'll get to see more of this. I absolutely LOVE the messaging system that is used in this book. - Ara's struggles are so human and so raw. She is experiencing so much guilt and pain and hurt and getting to see her work through each of these emotions is inspiring. Especially as her and Rogue get closer and she learns she can lean on him as well, that she is not alone. - While this is the start of a series, there is NO cliffhanger! There's a bit of a teaser of something major that is going to happen at the start of the next book, but it's not a cliffhanger in the sense that we aren't sure if someone is going to live or d!e or if they'll be separated. For that, I am very thankful! This book was so much fun that I will definitely be returning to book 2, even if it takes several months (or longer since this is an debut author) to publish! - Lastly, the cover is GORGEOUS! And I love the title! I'll copy a few of my favorite quotes below so you can have a little taste of the author's writing and the world she's cultivated. 😊 Top Highlights from The Last Storm On days like this, when my heart was heavy and my mind clouded, I resorted to books— to escape, to forget, to find freedom where I had none. If I were to marry him, my face would always be turned to the window, searching for more, and if not that, I would be a shell of the person I am now. I stepped back to admire her, thr0bbing at the sight. She was the most beautiful woman I had ever seen. To ever exist. Nothing, no one, had ever deserved to be worshiped more. All men should be made to kneel before her. But she would have to settle for me. The taste of her met my t0ngue as my scent merged with hers, forever branding her. Mine. I l!cked the wound. Hers. Completely and utterly hers. I didn’t claim her in ownership. I claimed her as my one. Devoted myself to one. With that mark, my body and soul were bound to her. I would never be with anyone else, emotionally or physically. It would be her or no one, until my last breath. “Scream my name. Let everyone know who I belong to.” I had never really cared about the weather before, but now, clear skies meant everything to me, and I was grateful to see another calm morning. “There will never be another woman for me.” He paused. “Ever.” I stilled at his words. “What… Why?” “This”— his thumb slid down across the mark—“ is a symbol of… surrender. I know you believe that it was my claim upon you, but it wasn’t. It never was. I bound my body and soul to you, little storm.” “I also know that it is more than this tiny, insignificant mark on your skin that binds me to you. It’s you. All of you. Your strength and resilience. Your determination to endure no matter what fate throws at you. Your love for love and stories and hope. You are entirely the opposite of everything that I am and I would gladly wear your shackles if it meant I could have you.” My mate. Mine. And then everything shifted and I understood. I understood everything. The surrender. The deep, soul-craving longing. Bound. I was bound to him. Body and soul. Entirely his. “I would’ve waited forever,” he whispered back, understanding. Seriously, everyone.. add this to your TBR!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 14, 2022

recommand products