SKU: 66351744927

Human Fetuin A, His tag

Sale price$144.00 Regular price$160.00
Save 10%

Pay in installments of $40.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 3 - Sep 8

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Fetuin A, His tagProduct Specification Species Human Synonyms Alpha 2 Z globulin, Ba alpha 2 glycoprotein, AHSG, FETUA Accession P02765 Amino Acid Sequence Protein sequence (P02765, Ala19 Val367, with C His tag)

Product Specification


Species Human
Synonyms Alpha-2-Z-globulin, Ba-alpha-2-glycoprotein, AHSG, FETUA
Accession P02765
Amino Acid Sequence

Protein sequence (P02765, Ala19-Val367, with C-His tag) APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV

Expression System HEK293
Molecular Weight Predicted MW: 39 kDa Observed MW: 55-60 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

alpha-2-HS-glycoprotein also known as fetuin-A belongs to the fetuin class of plasma binding proteins and is more abundant in fetal than adult blood. Alpha2-HS glycoprotein is synthesized by hepatocytes and adipocytes. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The mature circulating AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. AHSG is a secreted partially phosphorylated glycoprotein with complex proteolytic processing that circulates in blood and extracellular fluids. Fetuins are carrier proteins like albumin. Fetuin-A forms soluble complexes with calcium and phosphate and thus is a carrier of otherwise insoluble calcium phosphate. Thus fetuin-A is a potent inhibitor of pathological calcification, in particular Calciphylaxis. High levels of Fetuin-A are associated with obesity and insulin resistance.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 66351744927

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
NetherChicken
Natrona Heights, US
★★★★★ 4
Looks fine at a glance but definitely budget
Color: Ivory, Size: Large
I picked this up in the ivory color and the overall design leans very old school, especially with the oversized front buttons. They look nice from a distance, but up close they feel a bit cheap. The pants are one of the better parts, with a comfortable fit and an elastic waistband, and the included tie is a nice touch. Fit seems generally accurate, though having a size chart would have helped. The material is where the cost really shows, with a coarse polyester exterior and a smoother inner lining that helps with comfort. It gets the job done if you need something affordable in a pinch, just don’t expect it to feel or look high end up close.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2026
O
Omniman
Carnegie, US
★★★★★ 5
Great looking suit
This suit is very good looking. To me, it is hard to find a suit in a cream color like this, that actually looks good. This one pulled off the trick for me! The jacket is well made and if you look at the posted photos you will see that the hankie pocket is slightly slanted. That makes this suit a bit unique among others. It even comes with the Red Tie included! It is well made, great looking, fits right and feels great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2026
B
Brown Family
Cuba, US
★★★★★ 1
Too Wide and Not Long Enough for Tall, Skinny Builds
I bought this for my 16-year-old son (he’s about 6’2” and very tall and slender with a normal pant size of 30" 34") to have something simple in his closet for school dances and occasional events. Gray felt versatile — something he could dress up or down without overthinking it. Sizing was the biggest issue for us. I ordered a men’s large because that’s typically what I buy him for sweat pants, work out pants and for the added length in shirts, but this suit was way too big through the waist and chest. For something labeled “slim fit,” it did not fit like a slim suit at all. The inseam measured at 31 inches, which is shorter than other suits we’ve purchased for him, and the size chart (which wasn’t available when I ordered) doesn’t even list inseam measurements at all — which really matters for tall, lean boys like mine. As far as construction, this feels more like an occasional-wear suit for a teenager than something a grown man would wear regularly. The jacket is lined, which is nice, and it includes extra buttons. But there were loose threads inside around the buttons and pockets, and some stitching — especially under the arm pit area it already looked like it could come apart with wear. The inside pocket material feels thin and not especially durable. The arm length itself was a great fit for my tall son, and even offered a little room for growth. The pants were similar. When I turned them inside out, I noticed loose threads where the seams meet, particularly at the crotch. The pocket lining material feels rough, and there is only 1 extra inch of fabric at the hem if you need additional length, where I am used to seeing 2 inches of material for adjustments. I noticed that my son wore his belt on his hips when he tried it on so he pant legs would look more of a normal length. Overall, this might work fine as a backup suit for someone who needs it once in a while and isn’t overly concerned with tailoring or long-term durability. But based on fit and construction, it’s not something I would purchase for my husband or for frequent wear.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 18, 2026
D
Dave Daves Seaward
Grantham, US
★★★★★ 2
I dislike the royal blue - I abhor the cheap, tacky buttons
I requested this product without being able to see the product photo or any information about it (beyond the title) because I requested a similarly-priced 3-piece suit on Amazon previously and that was a fine suit; it wasn't amazing, but it was decent. This is far worse and I don't think many people would feel good about spending the $75 on this. I would never wear this suit jacket in public because it would embarrass me due to the color and the buttons. I suppose the color is a subjective choice, and I like many shades of blue and have two blue suits. A dark blue would've been OK with me (preferable), or even a lighter blue could be OK I suppose - but this "royal blue" shade is nauseating to me, its as if its trying to be overly-vibrant. The buttons aren't just a problem because they're cheap plastic - their placement is reminiscent of a style of suit jackets I've only ever seen in history books or old period movies set in eras well over a century ago - nobody wears jackets like this anymore unless they're dressed in formal uniforms like police. The title says it could be for a prom? No, I would not ever wear it to a prom or suggest it as a suit anyone would wear to a prom. The pants are decent! This is why I'm giving it two stars. Initially I couldn't imagine wearing this suit in any way whatsoever but the pants fit well and have a very professional-looking crease right where it should be. The color is bad, but I'll keep it in the back of the closet for days when I have no other slacks appropriate for work that are clean. I greatly appreciate the elastic in the waistband - it has that new stretchy type which allowed me to fit into it without trouble even though someone of my weight otherwise wouldn't.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 7, 2026
S
Sesirrah
Birmingham, US
★★★★★ 3
It's nice enough, but nothing spectacular
This was definitely a gamble since there was no picture provided.... But, my husband needed a newer suit, so we took a chance. Well, it's green! Which is the last thing we expected lol. But, it's not terrible. My husband actually thinks he can do something with it. I'm disappointed because it's only a jacket, pants and tie- not a three piece with a vest like i thought I was getting. Also the fabric just isn't a great material. For $80, it's not great. I've gotten better for $20 from temu. However, it does fit very him very nicely. He's about 5 foot nine or ten, 185lb. If you're in a bind and need a suit in a hurry, this will certainly do just fine. Just know it's not luxury. Pictures are taken right out of the bag, not ironed or anything.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 7, 2026

recommand products